KEGG   Pectobacterium parmentieri WPP163: Pecwa_3366Help
Entry
Pecwa_3366        CDS       T01106                                 

Definition
(GenBank) pseudouridine synthase
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
pwa  Pectobacterium parmentieri WPP163
Brite
KEGG Orthology (KO) [BR:pwa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pwa03016]
    Pecwa_3366
Enzymes [BR:pwa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     Pecwa_3366
Transfer RNA biogenesis [BR:pwa03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    Pecwa_3366
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: ACX89104
Position
complement(3693009..3693794)
Genome map
AA seq 261 aa AA seqDB search
MLEIIYQDEHLVAVNKPSGWLVHRSWLDRKEKVVVMQTVRDQIGQHVYTVHRLDRPTSGV
LLLALSSEVARALSQQFESHQMQKMYHAVVRGYVLDDGVIDYALTEELDKIADKFANPDK
APQPAVTHYRALAQVEMPVAIGRYPTARYSLMELKPQTGRKHQLRRHMSHLHHPIIGDTA
HGDLRHNRGMETHFSCGRLMLHASELQLNHPVSGQPLTLQARWDAPWQGVMRQFGWQGIL
PEFEGVEFLAESGQDSGNLVE
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgcttgagattatttatcaggatgagcatctggttgccgtcaataaaccgagtggctgg
ctggtgcatcgtagttggttggatcgcaaagaaaaggtcgtggtgatgcagaccgtgcgc
gatcaaattggtcagcatgtgtataccgttcatcgcctcgacaggccgacatccggtgtg
ttgctgctcgcgctgtccagcgaagtggcgcgcgcattatcccagcagtttgaatcgcac
cagatgcagaaaatgtatcatgccgttgtgcggggatatgtgctggatgacggcgtgatt
gactacgcgctcaccgaagagttggacaagattgccgataaatttgccaatcctgataaa
gcaccgcagcctgccgttacgcattaccgcgctttagcacaggttgagatgccggttgcc
atcggtcgttaccctacggcgcgctacagtttgatggagctgaagccgcagaccgggcgt
aaacatcagctacgccgtcacatgtcacatcttcaccatccgattatcggcgataccgcc
cacggcgacctgcgacacaatcgtggtatggaaacgcacttctcctgcggcaggctcatg
ctgcatgccagcgagttacagttgaatcatcccgtgagcgggcagccattaacgttgcag
gcacgctgggatgcaccgtggcagggggtgatgaggcagtttggctggcaagggattctc
cctgagtttgaaggggttgagtttcttgcagagtcaggtcaggatagcgggaatctcgtc
gagtaa

DBGET integrated database retrieval system