KEGG   Pectobacterium parmentieri WPP163: Pecwa_3454
Entry
Pecwa_3454        CDS       T01106                                 

Definition
(GenBank) type VI secretion system Vgr family protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
pwa  Pectobacterium parmentieri WPP163
Pathway
pwa03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pwa00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Pecwa_3454
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pwa02044]
    Pecwa_3454
Secretion system [BR:pwa02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Pecwa_3454
SSDB
Motif
Pfam: Phage_GPD Phage_base_V Gp5_C Phage_Mu_Gp45 Sarcoglycan_1 DUF2345
Other DBs
NCBI-ProteinID: ACX89191
Position
complement(3795317..3797284)
AA seq 655 aa
MANSTGLQFTVKVGALAAGTFAVVDFRLDEGLNRPFSLSLSLASVLPDVDFGAVLDQPCE
LMIWYEGELKRRISGIISGFTQGDTGFRRTRYQAEVRPELWRLGLRTNARIFQAQKPDAI
IGTLLEEAGITDYAFSLRHDHAPREYCVQYRESDLAFVTRLAAEEGLYFFHEFEEGKHRV
VFADDAGALAKGPELFFNLAAQGLSEGEYIRRFHYAERVSTAEVELKDYSFKTPAYGLSH
KKMSSELDHQRESYQHYDYPGRYKQDPSGKAFSNYRLDALRSGAVTSEGESNCAGLMPGN
TFTLTEHPNATLNTVWQTVSVMHIGQQSQALEEESGGEPTTMSNSFAVISAKKNWRAVMP
YKPMVDGPQIARVVGPAGEEIYCDKYGRIKLQFPWDRYGANNDQSSCWVRVSQGWAGGQY
GLIAIPRIGHEVIVSFLEGDPDQPIVTGRTFHATNPAPYPLPANKTRTTLRSKTHKGKGF
NELSFEDATDNEEIFLHAQKNMAVRVLNSKDERVDYNRTTSIGHDEALVVANDRKITVEG
NQDHKITGNNLSLTEGDRGIQVKGDLAQKISGVFSVDSNGDLTLQSGSKLTLRVGGSFVV
IHAGGVDIKGPAINLNSGGSPGDLALPADPAILKAAAAQGTMFVAHCPAKEKKGE
NT seq 1968 nt   +upstreamnt  +downstreamnt
gtggccaacagtacaggattacagttcaccgtaaaggtcggcgcattggcggccggcacc
tttgcggtggtggatttcaggctggatgaggggctgaatcggcctttcagcctgtcgctg
agtctggcgagcgtgttgccggatgtggattttggcgcggtgctggaccaaccgtgcgag
ctgatgatttggtatgagggtgagttgaaacgccggatcagtgggattatcagtggtttc
acacagggcgacaccggttttcgccgcacccgctatcaggcggaagtgcgtccggagctg
tggcggttgggattacgcaccaacgcccgtatctttcaggcccagaagccggacgcgatt
atcggtactctgctggaagaagccggcattaccgactacgccttttcgttacgtcatgac
catgccccgcgcgagtactgcgttcagtaccgggaaagcgatttggcgtttgtcacccga
ctggcggcagaggaaggcttgtacttcttccacgagtttgaggaaggcaaacaccgtgtc
gtctttgccgacgatgcgggagcgctggctaagggccctgagctgttcttcaatttggcg
gcgcaggggctgagcgagggggaatacatccggcgtttccactatgcggagcgggtgagc
acggcagaagtggagttgaaggattacagcttcaagacaccggcctacgggctgtcacat
aagaagatgagtagcgaattggatcaccaacgtgaaagttatcagcattacgactatcca
ggacgttataaacaagatccgagcggcaaagcgttcagcaactaccggctggatgcgctg
cgctctggagcggtgacgagcgaaggggaatcgaactgcgcagggctgatgccgggcaac
acgtttactctgacggaacacccgaatgcgacgctgaatacggtgtggcaaacggtgagc
gtgatgcatatcgggcagcagtcgcaggcgctggaggaggaaagcggcggtgagccgacg
accatgagcaacagctttgcggttatcagtgcgaaaaaaaactggcgggccgtcatgccg
tacaaaccgatggtggacggcccgcagattgcgagggtagtggggccggctggcgaagaa
atctactgcgacaagtacgggagaatcaaactgcaattcccgtgggaccgttatggggcg
aataatgaccagagttcctgctgggtgcgtgttagccagggctgggcgggcggccaatac
ggactgatcgctatcccgcgtatcggtcatgaagtgattgttagcttcctcgaaggtgac
ccggatcagccgattgtcactggacgtaccttccacgcgacaaatccagcgccgtatccg
ctgccagccaataaaacacgtaccacgctacgttcaaaaacacacaaaggaaaaggcttt
aacgaactcagttttgaggacgcgaccgataacgaagagatcttccttcatgcccagaag
aacatggcagtacgggtactgaattctaaagatgagcgagtggactataaccgaacaacc
agtattgggcatgatgaggcgctggtggtcgccaatgaccgtaagattacggtggaaggt
aatcaggatcacaaaatcacaggcaataatttatcgctgacggaaggcgatcgaggcata
caggttaagggcgatttggcgcagaaaatcagcggcgtgttcagcgtggacagcaatggc
gatctgacgctgcaaagtggcagcaaactgacactccgagttggaggcagctttgtggtt
atccacgccggaggcgttgacatcaaagggcctgctatcaacctgaactcaggcggcagc
ccaggcgacttggcactacccgccgatccggcgatattgaaagcggcggcggcacaggga
acgatgtttgtggcgcattgtccggcaaaggaaaaaaaaggtgagtga

DBGET integrated database retrieval system