KEGG   Pectobacterium parmentieri WPP163: Pecwa_3753Help
Entry
Pecwa_3753        CDS       T01106                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pwa  Pectobacterium parmentieri WPP163
Pathway
pwa00010  Glycolysis / Gluconeogenesis
pwa00020  Citrate cycle (TCA cycle)
pwa00620  Pyruvate metabolism
pwa01100  Metabolic pathways
pwa01110  Biosynthesis of secondary metabolites
pwa01120  Microbial metabolism in diverse environments
pwa01130  Biosynthesis of antibiotics
pwa01200  Carbon metabolism
Module
pwa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pwa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pecwa_3753
   00020 Citrate cycle (TCA cycle)
    Pecwa_3753
   00620 Pyruvate metabolism
    Pecwa_3753
Enzymes [BR:pwa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Pecwa_3753
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding RnfC_N GCV_H HlyD_D23 NQRA HlyD_3
Motif
Other DBs
NCBI-ProteinID: ACX89488
UniProt: D0KM09
Position
complement(4143114..4144997)
Genome map
AA seq 627 aa AA seqDB search
MAIEINVPDIGADEVEVTEVLVKVGDKVEAEQSLITVEGDKASMEVPSPQAGVIKEIKVS
VGDKVETGKLIMIFDSADGAVDAAPAKAEEKKEAAPAAAPVASAAKEVNVPDIGGDEVEV
TEVLVKVGDTVAAEQSLITVEGDKASMEVPAPFAGTVKEIKISTGDKVSTGSLIMVFEVA
GSAPAASAAKAEAAPAAAPAASAAKEVNVPDIGGDEVEVTEVMVKVGDKIAAEQSLITVE
GDKASMEVPAPFAGTVKEIKISTGDKVKTGSLIMVFEVEGAAPAAAPAAKQEAVAAPAPA
AKPAAPAAKAEGKSDFAENDAYVHATPVIRRLAREFGVNLAKVKGSGRKGRILREDVQAY
VKDAVKRAESAPVAAAGGGLPGMLPWPKVDFSKFGEVEEVELGRIQKISGANLSRNWVMI
PHVTHFDKTDITELEAFRKQQNVEAEKRRLDVKITPVVFIMKAVAAALEQMPRFNSSLSE
DAQRLTLKKYINIGVAVDTPNGLVVPVFKDVNKKGIVELSRELMAISKKARDGKLTAGEM
QGGCFTISSLGGIGTTHFAPIVNAPEVAILGVSKSAMEPVWNGKEFTPRLMMPMSLSFDH
RVIDGADGARFITIINNTLSDIRRLVM
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaaatcaacgtaccggacatcggtgcagatgaagttgaagtcaccgaagtg
ctggtgaaggtgggcgacaaagttgaagctgaacagtcgctgatcacggttgaaggtgat
aaggcttctatggaagtcccttctccgcaggctggtgtcattaaagagattaaagtctct
gttggtgacaaagttgaaactggcaaactgatcatgattttcgattccgccgacggtgca
gttgacgctgcacctgccaaggcagaagagaagaaagaagccgctccggctgctgcacca
gtggcctccgcagcgaaagaagtcaacgtgccggatatcggcggtgacgaagtcgaagtg
accgaagtgctggttaaagtgggcgacaccgttgctgctgaacaatctctgatcactgta
gaaggcgacaaggcttctatggaagttccggcacctttcgcgggtacggttaaagagatc
aaaatcagcactggcgacaaagtctccactggttctttgatcatggtatttgaagttgcg
ggcagtgcgcctgcggcctcagcagcgaaagctgaagcggcacctgctgctgcaccagcg
gcctctgcggcgaaagaagttaacgtaccggatatcggcggcgacgaagtcgaagtgact
gaagtgatggttaaagtgggcgataaaatcgcggccgagcagtcactgatcaccgttgaa
ggcgacaaggcttcgatggaagtcccagcgccgtttgcaggtacggttaaagaaatcaaa
atcagcaccggtgacaaagttaaaaccggctcactgattatggtcttcgaagtagaaggt
gctgcgcctgctgcggctccggctgccaagcaagaagcggttgctgcaccagctccggcg
gcaaaacctgccgcaccggcagcgaaggctgaaggcaagagcgatttcgcagagaatgac
gcttacgttcacgcgacgccggttatccgtcgtctggcacgtgaattcggcgtaaatctg
gcgaaagtgaagggttctggtcgtaaaggccgtatcctgcgcgaagacgttcaggcttac
gtgaaagatgccgtgaaacgcgctgagtctgcaccagtagctgccgctggcggcggtctg
ccaggcatgctgccatggccgaaagtcgatttcagcaagtttggtgaagtggaagaagtg
gaactgggtcgcatccagaaaatttctggtgctaacctgagccgtaactgggtgatgatc
ccgcacgttacgcacttcgataaaaccgacatcactgaactggaagcgttccgtaaacag
cagaacgtggaagctgagaagcgtagactggacgtgaagatcaccccagttgtcttcatc
atgaaagccgttgctgctgcccttgagcaaatgccacgtttcaacagttcactgtctgaa
gatgctcaacgtctgacgctgaagaaatacatcaacatcggtgttgcggttgatacgccg
aatggtctggtggttcctgtgttcaaagacgtgaacaagaaaggcatcgtcgaactgtct
cgcgaactgatggcgatctccaagaaagcccgtgacggtaagctgaccgcaggcgaaatg
cagggtggatgcttcactatctccagcctgggcggtatcgggactacgcactttgcgccg
atcgttaacgcgcctgaagtcgctattcttggcgtgtctaagtctgcgatggaaccggtc
tggaatggtaaagagttcacgccgcgtctgatgatgccgatgtctctgtccttcgaccac
cgtgtcattgacggtgctgatggggctcgcttcattaccatcattaacaacacgttgtct
gacatccgccgtctggtgatgtaa

DBGET integrated database retrieval system