KEGG   Pectobacterium parmentieri WPP163: Pecwa_4257
Entry
Pecwa_4257        CDS       T01106                                 

Definition
(GenBank) type VI secretion system Vgr family protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
pwa  Pectobacterium parmentieri WPP163
Pathway
pwa03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pwa00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Pecwa_4257
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pwa02044]
    Pecwa_4257
Secretion system [BR:pwa02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Pecwa_4257
SSDB
Motif
Pfam: Phage_GPD Phage_base_V Phage_Mu_Gp45 DUF2345
Other DBs
NCBI-ProteinID: ACX89981
Position
4703358..4705190
AA seq 610 aa
MANSTGLQFTVKVGALPASTFAVVDFQLSEALNRPFSLSLSLASALPDVDFGAVLDQPCE
LMIWYEGELKRRVSGIISGFTQGDTGFRRTRYQAEVRPALWRLGLRTNARIFQAQKPEAI
IGTLLEEAGITDYAFSLRHDHAPREYCVQYRESDLAFVTRLAAEEGLYFFHEFEEGKHRV
VFADDAGALAKGPELFFNLATQGLSEGEYVRRFHYAERVSTAEVELKDYSFKTPAYGLSH
KKMSSELAHQRESYQHYDYPGRYKQDPSGKAFSNYQLDALRSEAVTSQGESNCAGLMPGR
RFTLTEHPNATLNAVWQTVSVTHIGQQPQALEEESGGEPTTMSNSFEVISAKKNWRAIMP
YKPMVDGPQIATVVGPTGEEIYCDQYGRIKLQFPWDRYGASDDQSSCWVRVSQGWAGSQY
GMIAIPRIGHEVIVSFLEGDPDQPIVTGRTFHVTNRPPYELPTHKTRTVLRSRTHKGKGF
NELSFEDQSGQEEVFIHAQKDMNTVVLNNRSTKVNIDHSENVGRHQTIMVGENQGTEIRG
AQKITVAKGRKTEITTTEELTVTGDITVLSASGTIKLSTAGGYISIDNAGDINIVGNHLM
LNGVRIDLNQ
NT seq 1833 nt   +upstreamnt  +downstreamnt
atggccaacagtacaggattgcagttcactgtaaaggtcggcgcgttgccggcctcgacg
tttgcggtggtcgattttcagctcagcgaggcgcttaaccggcctttcagcctatcgctg
agtctggccagcgccctgccggatgtggattttggcgcggtgctggaccagccgtgcgag
ctgatgatttggtatgagggtgagctaaagcgtcgggtcagcgggattatcagtggtttc
acacagggcgacaccggttttcgccgcacccgctatcaggcggaagtgcgcccggcgctg
tggcggctgggcttacgtaccaacgcccgcatctttcaggcgcagaagccagaggcgatt
atcggcaccctgctggaagaagccgggattaccgactacgccttctcgttacgtcatgac
catgccccgcgtgaatactgcgtgcagtaccgggaaagtgatttggcgtttgtcacccga
ctggccgcagaggaaggcctgtacttcttccacgaatttgaggaaggtaaacaccgggtg
gtctttgccgacgatgccggcgcattggccaaaggccctgagttgttcttcaatttggcg
acacaggggctgagtgagggcgaatatgtccggcgtttccactatgccgagcgggtgagt
acggcagaagtggaattgaaggattacagtttcaaaacaccagcttacgggctgtcacac
aagaagatgagcagcgaactggcgcaccaacgtgaaagctatcagcattacgactatcca
gggcgttataaacaagatccgagcggcaaagcgttcagcaactaccagttggatgcactg
cgttcagaggcggtgacaagccaaggggaatcgaactgcgcggggctgatgccgggccgt
cgcttcacgttaaccgaacatccgaatgcaactctgaatgcagtgtggcaaacggtgagc
gtgacgcatatcgggcagcagccacaggcgctggaagaagaaagcggcggcgagccaacg
accatgagcaacagttttgaagttatcagtgcaaaaaaaaactggcgagccatcatgccg
tacaaacccatggtggatggcccacagattgccacggtggtagggccgactggcgaagaa
atctactgtgaccagtacggcaggatcaaactgcaattcccgtgggaccgctacggcgca
agtgatgaccaaagctcctgctgggtgcgagtgagtcagggctgggcgggcagccagtac
ggcatgatagccatcccgcgcatcggccatgaagtgattgtcagcttcctcgaaggtgac
ccggaccagccgattgtcaccggcagaacctttcatgtaactaaccgccctccttatgag
ttgcccacccacaagacgcgtaccgttcttcgttcaagaacgcataaaggaaaaggcttt
aacgaactgagctttgaagatcagtctggacaggaagaagtatttatccacgcccagaaa
gacatgaacaccgtggtgctcaataaccgcagcacaaaggtgaacatcgaccacagtgaa
aatgtgggtcgtcatcagacaatcatggttggcgaaaatcagggaacagaaatcagaggc
gcccagaagatcacggtggcaaagggccgcaagaccgaaatcaccacgactgaagaactg
accgtaaccggagatattaccgtgctgtcagccagcggcacgatcaaattatctaccgcc
ggtggatatatctctattgataatgctggcgatatcaacattgtcggcaaccacctgatg
ctgaatggcgtacgcatcgatttgaaccagtag

DBGET integrated database retrieval system