KEGG   Pectobacterium wasabiae: A7983_01485Help
Entry
A7983_01485       CDS       T04535                                 

Definition
(GenBank) hypothetical protein
  KO
K14188  D-alanine--poly(phosphoribitol) ligase subunit 2 [EC:6.1.1.13]
Organism
pws  Pectobacterium wasabiae
Pathway
pws00473  D-Alanine metabolism
pws01100  Metabolic pathways
pws01503  Cationic antimicrobial peptide (CAMP) resistance
pws02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pws00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    A7983_01485
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A7983_01485
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    A7983_01485
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:pws01504]
    A7983_01485
Enzymes [BR:pws01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.13  D-alanine---poly(phosphoribitol) ligase
     A7983_01485
Antimicrobial resistance genes [BR:pws01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]
    A7983_01485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PP-binding
Motif
Other DBs
NCBI-ProteinID: AOR61968
UniProt: A0A1D7YWG4
Position
complement(308756..308977)
Genome map
AA seq 73 aa AA seqDB search
MEQEILALFEKILSRKVGFNDELIESDILDSILAVDLVLEVQDVYGCVIPPTEVATVLKT
PAELARYIEENRG
NT seq 222 nt NT seq  +upstreamnt  +downstreamnt
atggaacaagaaatactcgcgctgtttgaaaagatcttatcccgtaaagtgggctttaat
gatgaactgattgagtccgatattctcgactcgattctggcggtcgatctggtgttggaa
gtgcaggacgtttacggctgtgtgatcccgccaactgaagtcgctaccgttctgaagacc
ccagcagaattggctcgctacattgaagagaaccgcggctaa

DBGET integrated database retrieval system