KEGG   Pectobacterium wasabiae: A7983_07930Help
Entry
A7983_07930       CDS       T04535                                 

Definition
(GenBank) glucose-1-phosphatase
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
pws  Pectobacterium wasabiae
Pathway
pws00010  Glycolysis / Gluconeogenesis
pws01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pws00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A7983_07930
Enzymes [BR:pws01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     A7983_07930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase SHOCT Acid_PPase HAD Hydrolase_like Hydrolase_6 Phage_GPD PNK3P
Motif
Other DBs
NCBI-ProteinID: AOR63184
UniProt: A0A1D7YZW4
Position
1773951..1774562
Genome map
AA seq 203 aa AA seqDB search
MLYIFDLGNVVIDIDFKRVLGVWSNLSSAPLATLQERFVMGEAFEQHERGEISDEEFATR
LCQEMGIALSFEQFTAGWQAIFVALRPEVIDVMQRLRQEGHRVVILSNTNRLHCSHWPAL
FPEVGTAADRLYLSQDIGLRKPELAIYQHVLTQEGVTPAQAVFFDDNAANVDAAQSLGIH
SILVTDRQVVPDFFAMQTTTAKA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgctgtatatctttgatttgggtaatgttgtcattgatattgatttcaaaagagtattg
ggcgtctggagtaatctgagcagcgcgccgctcgcaacgttgcaagagcgttttgtgatg
ggtgaggcgtttgaacagcatgagcggggcgaaattagcgacgaggaatttgccaccaga
ctgtgtcaggaaatgggtattgcactgagtttcgagcaattcaccgctggctggcaggct
atttttgtcgcactgcgtcctgaggttatcgacgtcatgcagcgcctgcgtcaggaaggc
caccgcgtggtgattctgtcgaataccaatcgcctccattgttcacactggcctgcgtta
tttccagaagtgggaacggctgccgacagactttatttgtcgcaagacattgggctacgt
aagcctgaattggcgatttatcaacatgttctgacgcaagaaggcgttacgccagcgcag
gccgtgttttttgacgataatgccgcgaatgtcgatgctgcgcaaagcttgggaattcac
agcattctggtgaccgatcgtcaggtggtgccagactttttcgctatgcagacaacgacg
gccaaagcatga

DBGET integrated database retrieval system