KEGG   Pectobacterium wasabiae: A7983_14855Help
Entry
A7983_14855       CDS       T04535                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pws  Pectobacterium wasabiae
Pathway
pws00071  Fatty acid degradation
pws00280  Valine, leucine and isoleucine degradation
pws00310  Lysine degradation
pws00362  Benzoate degradation
pws00380  Tryptophan metabolism
pws00620  Pyruvate metabolism
pws00630  Glyoxylate and dicarboxylate metabolism
pws00640  Propanoate metabolism
pws00650  Butanoate metabolism
pws00900  Terpenoid backbone biosynthesis
pws01100  Metabolic pathways
pws01110  Biosynthesis of secondary metabolites
pws01120  Microbial metabolism in diverse environments
pws01130  Biosynthesis of antibiotics
pws01200  Carbon metabolism
pws01212  Fatty acid metabolism
pws02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pws00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A7983_14855
   00630 Glyoxylate and dicarboxylate metabolism
    A7983_14855
   00640 Propanoate metabolism
    A7983_14855
   00650 Butanoate metabolism
    A7983_14855
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A7983_14855
   00072 Synthesis and degradation of ketone bodies
    A7983_14855
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A7983_14855
   00310 Lysine degradation
    A7983_14855
   00380 Tryptophan metabolism
    A7983_14855
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A7983_14855
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A7983_14855
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A7983_14855
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pws04147]
    A7983_14855
Enzymes [BR:pws01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A7983_14855
Exosome [BR:pws04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A7983_14855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AOR64510
UniProt: A0A1D7Z3N8
Position
complement(3298404..3299582)
Genome map
AA seq 392 aa AA seqDB search
MNDSVVIVNAKRTAIGKFAGSLANTSAIEMASATIRDCLSTLPDTLAIDEVILGNVLQAG
LGQNPAHQASQAAGIAVETPSLTVSKVCGSGLKAVVLGAQSILSGDNHVCVTGGMENMSA
APYLLEKARHGYRMGDGKLVDIMINDGLWCAFNDYHMGTTAENIAERYQLTREEQDQVAL
ASQQKAVAAIEAGRFKAEITPLSLRSKKETRIFDRDEFPRADTTLASLAALRPAFSANGT
VTAGNASGINDAAATLVLMRESEAKKQGITPLARIRSWASAGVPSEVMGLGPIPATQKAL
LKAGLTIGDIDLIEANEAFAAQFLAVQRDLQLDPEKVNVNGGAIALGHPIGASGARILVT
LVHALHSYNKTLGLATLCIGGGQGIAMIIERV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaacgactccgttgttattgttaatgccaagcgcacggcgattggtaaatttgcaggc
agtctggccaacacctctgctatcgagatggcctctgccaccatccgtgactgtctgtca
acgctgccagacacgctggcgatcgatgaagtgattctcggcaacgtgctgcaagccggt
ctgggacaaaacccggcgcaccaggccagccaggccgccggtatcgccgttgaaacgccc
tcgctgaccgtcagcaaagtatgcggctccggcctgaaagccgttgtgctgggcgcacag
tctattctgtccggcgataatcacgtctgcgtgacgggcgggatggaaaacatgagcgct
gcgccttacctgctggaaaaagcgcgccacggctatcggatgggggatggcaagctcgtc
gacatcatgattaacgatggtctgtggtgtgcgtttaacgattaccacatgggcaccacg
gcggaaaatatcgccgagcgctatcagctcacccgcgaagaacaggatcaggtcgcgcta
gcatcgcagcagaaagccgtcgccgcgattgaagctggccgcttcaaggcagaaattacc
ccgctgtcgctgcgcagcaaaaaagagacgcggattttcgatcgggatgaattccctcgc
gcagacactacgctggcatcgctggcggcgttacgtccggcattctccgcgaacggcact
gtcaccgcaggaaatgcgtccggcattaacgatgccgccgcaacgctggtattaatgcgt
gaatccgaagcgaaaaaacagggcattaccccgctagcgcggatccgcagttgggcgtct
gctggcgtaccgagtgaagtgatggggctggggccgattccggcgacgcagaaagcactg
ctcaaggctgggttgaccatcggtgatatcgacctgattgaagccaatgaagcctttgca
gcacagttcctagcggtacagcgcgatctccagctcgacccagaaaaggtgaacgttaac
ggcggtgcaattgcgttgggtcaccctatcggcgcgagcggtgcgcgtattctcgtcacg
ctggtacatgcgctgcacagctataacaaaacgctggggttggcaacgctgtgcatcggc
ggtgggcaaggtatcgccatgattatcgaacgcgtttaa

DBGET integrated database retrieval system