KEGG   Pectobacterium wasabiae: A7983_21300Help
Entry
A7983_21300       CDS       T04535                                 

Definition
(GenBank) two-component system sensor histidine kinase NarQ
  KO
K07674  two-component system, NarL family, nitrate/nitrite sensor histidine kinase NarQ [EC:2.7.13.3]
Organism
pws  Pectobacterium wasabiae
Pathway
pws02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pws00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A7983_21300
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pws01001]
    A7983_21300
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:pws02022]
    A7983_21300
Enzymes [BR:pws01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     A7983_21300
Protein kinases [BR:pws01001]
 Histidine kinases
  NarL family
   A7983_21300
Two-component system [BR:pws02022]
 NarL family
  NarQ-NarP (nitrate respiration)
   A7983_21300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PilJ HisKA_3 HATPase_c HAMP HATPase_c_2 HATPase_c_3 EamA ApoLp-III
Motif
Other DBs
NCBI-ProteinID: AOR65753
UniProt: A0A1D7Z757
Position
complement(4692568..4694286)
Genome map
AA seq 572 aa AA seqDB search
MVKRPVSTSLARAFFYIALLSFLTTGIALLTLASGLRDAEAVNVAGSMRMQSYRMGYDLQ
GDRAALDAHRHLYAQTLDSPVFHLLDRWYVPRDVRDRYTALLQNWKTMDERLNAGDRVWY
QDNIVHYVTQIDLFVLALQHYSERKMMIVVVTSIIGSITIYILIFFTLRRIRRQVVVPLN
KLMAACASIEKGRFTHSRLDVNLPNELGLLARTFSSMTDELQKLYRSLEDKVRQKTLRLQ
EVNRMLKVLYNCSQAMNVSTIDRHCFQQILQIVCRYETVDCLEMRVGENWLLCEGLPDAQ
VAWQALPIRLQEVEFGQLRWQASTQPPSAQVMESVANMLGRGLYFNQAQKHYQQLLLMEE
RATIARELHDSLAQVLSYLNIQMTLLKRAVAEENAQARQIITDFEQALSDAYRQLRELLG
TFRLTLQQADLPAAMQEMIAPLRAQTQATIAIDCRIPTQALDASQQVHLLQIIREAVLNA
IKHAQATTITVNCRMQPDGSHCVDIRDDGCGIANQEEPAGHYGLNIMQERAERLGGRLSI
GLHPEGGTQVSVHFSTPTTARERDNTNNLYPE
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaacgccctgtttctaccagcctggcccgcgcttttttttatatcgcgttgctt
tcattcctgacgacaggtattgcgctgctgacgttagccagtggcttacgcgatgcggaa
gcggtcaacgttgcgggttccatgcgcatgcaaagctatcgcatggggtatgatctgcag
ggcgatcgcgcagcgttagacgcgcatcgccacctctatgcgcaaacgctggattctccg
gtgtttcacctgttagatcgctggtatgtaccgcgtgatgtacgcgatcgctataccgcg
ctgttgcagaactggaaaacgatggacgagcgcctgaacgcgggggatcgggtgtggtat
caggacaatattgttcactatgtcacacagatcgatctctttgtgctggcattgcaacat
tattccgaacgcaagatgatgatagtggttgtgacatcaataattggttcgatcactatc
tatatactgatcttctttacgctgcgccgtattcgtcgtcaggtggtcgtgccgttgaat
aagctgatggcagcctgtgcatctattgaaaaggggcgttttacccattcgcgcttggat
gtcaatctgcctaacgaattgggattgctggcgcgaaccttcagcagcatgactgacgaa
ttgcaaaagctctatcgttctctggaagacaaggtacggcagaaaacgctgcgtttgcag
gaagtgaaccgcatgctgaaggtgctgtacaactgctctcaggcgatgaatgtcagtacg
atcgacaggcattgctttcagcagattctgcaaattgtttgccgctatgaaacggtcgac
tgcctggaaatgcgggtaggggagaattggctgttatgcgaaggcctgccggacgcacag
gttgcgtggcaggcgctgcccatccgcttgcaagaggtggagtttgggcaactgcggtgg
caggcatcaacgcaaccgccgtcggcgcaggtaatggagagcgttgccaatatgctgggc
cgcggtctctattttaatcaggcacagaagcactaccagcaactgttactgatggaagaa
cgcgctactatcgcgcgtgaactgcatgactcactggctcaggtgctttcttatctgaat
atccagatgacattgctaaagcgcgcagtagcggaagaaaatgcgcaggcccggcagatt
atcaccgattttgaacaggcgttgagcgatgcttaccgccaactgagagagttgctggga
acgttccggttgacgctacaacaggccgatttgcctgcggcgatgcaggaaatgatcgcg
ccgctacgggcgcagacccaggcgacaatcgcgattgattgccggatccctacgcaggcg
ttggatgcatcacagcaggttcacctgctacaaatcattcgtgaagcggtgctgaacgcg
attaaacacgcgcaggcgacaacgattaccgtcaactgtcgtatgcagcctgacgggagc
cattgtgttgatattcgtgatgacggctgtggcattgccaatcaagaggaacccgcagga
cattacggtttaaatattatgcaggaacgcgccgaacggttaggagggcggctatctatt
ggccttcatcctgaaggggggacgcaagttagcgttcatttttcgacgccgacgacagcg
cgtgaacgcgacaacacgaacaatctctaccctgaataa

DBGET integrated database retrieval system