KEGG   Pyrus x bretschneideri (Chinese white pear): 103930297Help
Entry
103930297         CDS       T03446                                 

Definition
(RefSeq) uncharacterized protein LOC103930297
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    103930297
Enzymes [BR:pxb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     103930297
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PHP
Motif
Other DBs
NCBI-GeneID: 103930297
NCBI-ProteinID: XP_009337893
Position
Unknown
AA seq 437 aa AA seqDB search
MDATNNSSSPKKTARKKKKRGGSGSKKKMTAEQTLAFKSVSEWVFLEQHQASSAAASDDF
GVSLVQRSTPNKLLFELHSHTNCSDGFLSPSKLVERAHENGVKVLALTDHDTMSGIPEAL
EAARRHRIKIIPGVEISTKFYPRGESAPEEPVHILAYYSSCGPTSFEDLETFLSNIRDGR
YLRAKNMVLKLNKLKFPLKWEHVAKIAGKGVAPGRVHVARAMVEAGYVENLKQAFARYLY
DGGPAYSTGSEPLAEEAIKLICDTGGVAVLAHPWSLKNPVAIVKSLKEAGLHGIEVYRSD
GKLAVYSDLADTYDLLKLGGSDYHGRGGHRESELGSVNLPVLVLRDFLKVARPIWCCSIR
RILENYAEEPSDLNLARVTRFEKGGSHLSCGKDLIDRCFNLWLTSDERQNAVFEAIRLKL
SHVSINKGGIQVLIEST
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggatgccacaaacaactccagcagcccaaagaaaacagcgaggaagaagaagaagcga
ggtgggagcgggagcaagaagaagatgaccgccgagcagactttagctttcaagtctgtg
agtgaatgggttttcttggaacagcaccaagcttcttccgctgcagcgtcggatgatttt
ggggtttcgttggtgcaaaggagcactccaaacaagctactctttgaattgcattcccat
acaaattgcagtgatgggtttctttcgccttccaagctcgtcgagagggctcacgaaaat
ggggtgaaagttcttgctctgacagatcatgacacaatgtctggcatccccgaggcccta
gaagcagctcggagacatcgcattaagataattccaggtgttgaaataagtacaaaattc
tacccaagaggagagtctgcaccagaggagccagttcacatccttgcatactacagcagc
tgtggaccaacaagtttcgaagatctggaaacgttcttgtcaaatataagggatggtcgt
tatcttcgtgcaaaaaatatggtcttgaaattgaacaagctcaagttccctcttaaatgg
gagcatgtcgcaaagattgcaggcaagggagttgctcctgggagagtgcatgtggcccgt
gcgatggttgaagccggctatgtggaaaatttgaaacaagcttttgcccgctatctttac
gatggtggaccagcatactctacgggaagcgaacctctggcagaagaagcaataaaactg
atatgtgacacgggaggtgtggctgtgctagctcatccttggtcattgaaaaatccagtt
gccatcgtcaaaagtttgaaagaagctggtcttcatgggatcgaagtttacagaagtgat
ggaaaactagctgtgtacagtgatcttgctgatacttatgatctgctgaagcttggaggg
tcagattaccatgggagaggtgggcatcgcgagtccgagctgggtagtgtgaatcttcca
gtattggttttgcgtgactttcttaaagtagctcgaccaatttggtgctgttccattcgg
cgcattctagaaaattatgccgaggagccttcggatttgaatctagcaagggttacgagg
tttgagaaaggaggttcccacttaagctgcggcaaggacctgattgatcgttgcttcaat
ttgtggttgacaagtgatgagaggcagaatgcagtttttgaggccattagattgaagctt
tcccatgtttcaattaataagggaggtatccaggttcttatagagagtacataa

DBGET integrated database retrieval system