KEGG   Pyrus x bretschneideri (Chinese white pear): 103931072Help
Entry
103931072         CDS       T03446                                 

Definition
(RefSeq) probable mediator of RNA polymerase II transcription subunit 37e
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Pathway
pxb03040  Spliceosome
pxb04141  Protein processing in endoplasmic reticulum
pxb04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    103931072
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103931072
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103931072
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 103931072
NCBI-ProteinID: XP_009338761
Position
Unknown
AA seq 656 aa AA seqDB search
MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
QVAMNPINTVFDAKRLIGRRISDASVQSDMKLWPFKVTSGPGDKPMIGVSYKGEDKLFAA
EEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGINVLRIINEP
TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD
NRMVNHFVQEFKRKNKKDISGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLYEGIDFY
STITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQDFF
NGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSXXXXXXLSLGLETA
GGVMTVLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPP
APRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK
SEDEEHKKKVESKNALENYAYNMRNTIKDEKIGAKLPPADKKKIEDSIETAIQWLDSNQL
AEADEFEDKMKELESICNPIIAKMYQGAGGDGAGPVDDDDAPPSASGPGPKIEEVD
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atggccggtaaaggagaaggtccggccatcggaatcgatctcggcaccacatactcatgc
gtcggtgtttggcaacacgaccgtgtagagatcatcgccaacgaccagggtaacagaacc
accccgtcgtacgttgctttcactgataccgagcggttgatcggagatgccgctaagaat
caggtcgccatgaaccccatcaacaccgtcttcgatgctaagaggttgattggtcgtaga
atttctgatgcctctgtccagagcgacatgaagttgtggccgttcaaggttacctccggc
cctggtgacaagcccatgatcggagtctcctacaagggagaagacaagctctttgccgcc
gaggaaatctcgtctatggttctcatcaagatgcgtgagatcgccgaggcctaccttggc
agcaccatcaagaacgctgttgtcacagtccctgcctactttaatgattcccagcgtcag
gccaccaaggatgccggagttattgctggaatcaatgtcctccgtatcatcaatgagccc
acagctgctgccattgcttatggtcttgacaagaaggccaccagcgttggtgagaagaat
gtcttgatcttcgatcttggaggtggtacttttgatgtgtctcttctcaccattgaggag
ggtattttcgaggtcaaggccacagccggtgacacacatttgggaggagaagattttgac
aacagaatggtgaaccactttgttcaggagttcaagaggaagaataagaaggatatcagc
ggcaaccccagagccctcaggaggttgaggacatcttgtgaaagggcgaagagaaccctc
tcttccaccgctcagaccaccattgaaatcgactccctttacgagggtatcgatttctac
tccaccatcacccgtgccagatttgaggagttgaacatggatcttttcaggaagtgtatg
gagccagttgagaaatgtttgagggatgccaagatggacaagagcaccgtccacgatgtc
gttcttgttggaggatccacccgtattcctaaagtacagcagcttcttcaggacttcttc
aacggcaaggagctctgcaagagcatcaaccctgatgaggctgtcgcctatggtgctgct
gtccaggctgccattctcagtggagagggcaacgagaaggtccaggaccttcttctgttg
gatgttacccctctttccnnnnnnnnnnnnnnnnntctttccctcggattggaaactgcc
ggaggtgtcatgactgtgttgatccccagaaacaccaccatccccaccaagaaggaacag
gtcttctcaacctactccgacaaccagcccggagtcttgattcaggtgtatgaaggagaa
agaacaagaaccagggacaacaatttgctcggaaagttcgagctctccggaatcccacca
gcacccagaggagtaccccagatcactgtctgcttcgacattgacgctaacggtatcttg
aatgtctccgccgaggacaagaccaccggacaaaagaacaagatcacaatcaccaacgac
aagggcaggttgtccaaggaggagattgagaagatggttcaggaggccgagaagtacaag
tcggaggacgaagagcacaagaagaaggtggagagcaagaacgccttggagaactatgcc
tacaacatgaggaacaccatcaaggacgagaagattggggccaagctgccgccggccgac
aagaagaagatcgaggactcgatcgagactgccatccaatggttggacagcaaccagctg
gcggaggccgatgagtttgaagacaagatgaaggagttggagagcatctgcaacccaatc
atcgccaagatgtaccagggagctgggggcgacggtgccggcccagttgatgatgatgat
gctccacctagtgccagcggcccaggccccaagatcgaggaggtcgactaa

DBGET integrated database retrieval system