KEGG   Pyrus x bretschneideri (Chinese white pear): 103931243Help
Entry
103931243         CDS       T03446                                 

Definition
(RefSeq) pyruvate decarboxylase 2-like
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Pathway
pxb00010  Glycolysis / Gluconeogenesis
pxb01100  Metabolic pathways
pxb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103931243
Enzymes [BR:pxb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     103931243
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C Cys_rich_CWC
Motif
Other DBs
NCBI-GeneID: 103931243
NCBI-ProteinID: XP_009338952
Position
Unknown
AA seq 606 aa AA seqDB search
MATSIGSLDSSKPANNNVGCPPQNGTATIHDSSHPPSTIASADSTLGRHLARRLVEIGVG
DVFTVPGDFNLTLLDHLIAEPKLTNIGCCNELNAGYAADGYARERGVGACVVTFTVGGLS
VLNAIAGAYSENLPVICVVGGPNTNDYGTNRILHHTIGLPDFSQELRCFQTVTCYQAVVN
NLDDAHEQIDTAISTALKESKPVYISISCNLPGIPHPAFSTHPIKFSISPRMTNKMGLEA
AVEAAAAFLNKAVKPVVVGGPKIRVAKAHEAFVEFADASGYAVAMMPSAKGRFPETHPRY
IGTYWGAVGTAYCGEIVESADAYLFAGPIFNDYSSVGYSLLLKREKAIIVQPDRVVVGNG
PSFGCVLMKDFLQALAQRVTKNTTAHENYTRIFVPDGQPLKSQPNEPLRVNILFQHIQKM
LSADTAVIAETGDSWFNCLKLKLPEGCGYEFQMQYGSIGWSVGATLGYAQSVPKKRVIAC
IGDGSFQVTAQDVSTMIRCNQKSIIFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIH
NGEGNCWTTKVRTEEELTEAIATATEEKKDCLCFIEVIAHKDDTSKELLEWGSRVSSANS
RPPNPQ
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atggccaccagcattggctctctagactcatcaaaacccgccaacaacaacgtcggctgc
cctcctcaaaacggtactgccaccatccacgactcttcccaccctccgtccaccattgcc
tccgctgactccactcttggccgccacttagcgcgccgcctggtggagattggggtgggg
gacgtgttcactgtccccggggattttaacttaaccctattagaccacctcattgctgag
ccgaagctcaccaacatcggctgctgcaatgagctcaatgccgggtacgccgctgatgga
tatgcccgggagcgtggcgttggggcttgcgttgtcacgtttaccgtgggtgggcttagt
gttctcaacgccattgctggagcttacagtgagaaccttcctgttatttgtgttgttgga
gggccaaacacaaatgattatggcaccaacagaattcttcaccacaccattggcttgccg
gatttcagccaagaactcagatgcttccagactgtcacttgctatcaagctgtggtaaac
aacttggatgatgcacatgaacaaattgatactgccatttctactgctctcaaagaaagc
aagcctgtctatatcagcattagctgcaacttgcctggcattccacatccagcttttagc
acacaccccattaaattttccatctcacctagaatgaccaacaagatggggctagaagcc
gctgtggaggccgcagctgccttcttgaacaaggcagtgaagccagttgtggttggcgga
ccaaagatccgagtggcaaaggcacatgaagcctttgttgaatttgctgatgctagtggc
tatgctgttgccatgatgccatcagccaaagggcgtttccccgaaacccatcctcgctac
atcgggacatactggggagcagtcggcacagcctactgtggtgagattgtagagtccgcc
gatgcatacttgtttgctggtccaatcttcaacgactacagctctgttggatactctctt
cttctcaagagggagaaggcaattattgtgcagcctgatcgtgtggtggttggcaatggc
ccttctttcgggtgtgtcctaatgaaagactttcttcaggcacttgcacagcgtgtcacc
aaaaacacaaccgctcacgaaaactataccagaatcttcgtcccagatggccagcctctc
aaatctcagcctaatgagcctcttagagtgaacattctgttccagcacattcagaaaatg
ctctctgctgacaccgcggttattgctgagaccggtgattcttggtttaactgcttgaaa
ttgaaactgccggaaggatgtgggtacgaattccagatgcaatacggatcgattggttgg
tctgttggtgcaactctaggctatgcacagtcagttccgaagaagcgcgtcattgcttgc
atcggtgatgggagcttccaggtgactgcacaagatgtgtcaacaatgattcgatgcaat
caaaagagcatcatcttcctcataaacaatggcggatacaccatagaagttgaaatccat
gacggcccttacaatgtgatcaagaactggaactacactggtttggtggacgcaatccac
aacggcgaaggaaactgctggacaacaaaggttcgtactgaggaggagctaacggaggca
attgcaacagcaacggaggagaagaaagactgcttgtgcttcatagaagtgattgctcac
aaggatgacacaagcaaagagctgcttgaatgggggtcaagggtctcatctgccaatagc
cgcccgccaaatcctcaatag

DBGET integrated database retrieval system