KEGG   Pyrus x bretschneideri (Chinese white pear): 103931587Help
Entry
103931587         CDS       T03446                                 

Definition
(RefSeq) 8-amino-7-oxononanoate synthase-like isoform X1
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Pathway
pxb00780  Biotin metabolism
pxb01100  Metabolic pathways
Module
pxb_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    103931587
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pxb01007]
    103931587
Enzymes [BR:pxb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     103931587
Amino acid related enzymes [BR:pxb01007]
 Aminotransferase (transaminase)
  Class II
   103931587
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 103931587
NCBI-ProteinID: XP_009339378
Position
Unknown
AA seq 461 aa AA seqDB search
MRHWDQWAEEALHKLDRLQLLRSLRPIYLHNGPIQEAQKSAEDEFNVFDEMQTWDRSSVE
VHIPEPTFEKWLHDIPSSGDEEGTQKFKKLLLFSGNDYLGLSSHPTIGKAAAKAALEHGM
GPRGSALICGYTDYHRRLESCLADLKKKEDCLLCPTGFAANMALMVALGNLGSLLSAGKM
PLTNEKIAIFSDALNHASIIDGIRLAERQKSVEIFIYRHCDMTHLNALLSSCTMRKKVVV
TDSLFSMDGDFAPITELVKLRREHDFLLVIDDAHGTFVCGKNGGGVAEEYNCEGDVDICV
GTLSKAAGCHGGFIACSKRWKQFIQSRGRSFIFSTATPIPIAAAAHAAVFVARKETWRRR
EIWNRVKDFRALTGIPINSPIISLIVGSEEKALQASQSLLKSGFHVTAIRPPTVPPNSCR
LRVTLSATHTRNDVERFTAALSRCVNFQEIGIHGSNGYARL
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgaggcattgggaccagtgggccgaagaggctcttcacaagcttgatcgtctgcagctt
cttcgttctctcagacccatttacctccataatggaccgatccaagaagcccagaaatct
gccgaagatgaattcaacgtgttcgatgaaatgcagacatgggaccgctcgtctgtggag
gttcacattcccgaacccacattcgaaaaatggctccatgacattcccagttccggagat
gaggaaggtacccagaagtttaaaaagctgctacttttctctggaaatgactatttaggc
ttgagttcacatcctactattggaaaagctgctgctaaggcagcgctagaacatggaatg
ggcccgaggggttctgctttaatttgtggatacactgattaccataggcgattggagtca
tgcttagcagacttaaagaagaaagaggattgccttctttgtcccacagggtttgcagcc
aatatggccttgatggtagctttgggaaatcttggctctcttttgtccgctggaaaaatg
cctttaactaatgaaaagattgcaattttctctgatgcactgaaccatgcgtcaataatc
gatggtattcgtcttgctgaacgacaaaaatctgtagagatattcatctatagacattgt
gacatgacacaccttaatgcgttgttatcaagttgcacaatgaggaagaaagttgttgtg
actgatagcttgtttagtatggacggagactttgcaccaatcactgagcttgtgaagcta
cgcagggagcatgactttctgttagttattgatgatgctcatggaacatttgtttgtgga
aaaaatggtggtggagtggctgaggaatacaattgtgaaggtgatgttgacatatgcgtt
gggactttaagtaaggctgcaggttgccatggcggattcatcgcatgcagcaaaaggtgg
aagcaattcatacaatcaaggggtcgttcttttatattttcaactgctacgccaatacca
attgctgctgctgctcatgctgctgtttttgtggcaagaaaggaaacatggcgtagaagg
gaaatttggaatcgggtgaaagactttcgtgctctcactggaattcccataaacagtccc
ataatatcgctcatagtagggagcgaagagaaggctctgcaagccagccagagtttgcta
aaatctggcttccatgtgactgcaatcagacccccaacagtgccacccaactcatgcagg
ttacgtgtgacattgagcgcaacgcacacgaggaacgatgtcgagaggttcacagctgca
ctctcccgttgcgtcaatttccaagaaattggcatccatggctcaaatggatatgcaagg
ctttag

DBGET integrated database retrieval system