KEGG   Pyrus x bretschneideri (Chinese white pear): 103931816Help
Entry
103931816         CDS       T03446                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase kinase 2-like
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pxb01001]
    103931816
Enzymes [BR:pxb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     103931816
Protein kinases [BR:pxb01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   103931816
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo Pkinase_fungal APH
Motif
Other DBs
NCBI-GeneID: 103931816
NCBI-ProteinID: XP_009339620
Position
Unknown
AA seq 288 aa AA seqDB search
MTEALKRDYQLCEEIGRGRFGVVFKAIRNGDTFAVKSIHKRIADSGDSLDAQCLLTEPKI
LKLLGSHPNVVNLHDLYEDDDHLHMVLDLCDAPDLYRRVTLRVFSESEAALVMTQLMHAV
AHCHSLGVAHRDIKPDNILFDGQERLRLADFGSAENFSEEEKMSGVVGTPYYVAPEVVAG
REYGEKVDVWSCGVVLYIMLAGFPPFYGETAAEIFDAVLRANLRFPARAFNSVSADLKDL
LRRMLCKDVSRRFSAEQVLRHPWITSGGVLGGGQSCGPVADSAGIAMD
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaggcactgaagcgggactaccagctgtgcgaggagatcggccgcggacggttc
ggcgtcgttttcaaagcgatccgaaacggcgacactttcgccgtcaaatcgatccacaag
cgaatcgccgactctggcgactcgctcgacgcccaatgcctcttgacggagcccaagatt
ctgaagctcctgggttcgcacccgaacgttgtcaacctccacgacctctacgaggacgac
gaccacctccacatggtcctcgacctctgcgacgcgcccgatctctaccgtcgagtcact
ctccgggtcttctccgagtccgaggccgccttggtcatgactcagctcatgcacgccgtc
gcacactgccacagcctcggcgtcgctcaccgtgacatcaagccggacaacatcctcttc
gacggccaggaacggctccggctcgccgatttcggatcggccgagaatttcagcgaggag
gagaagatgagcggcgttgtcggaacgccgtactacgtggcgccggaggtggtggcggga
agggagtacggtgagaaagtcgacgtctggagctgcggtgtcgttttgtacataatgctg
gccgggttcccgccgttttacggcgaaacggcggcggagatcttcgatgcggtgctaaga
gcgaatttgagatttccggcgagggcttttaactccgtgtcggccgaccttaaggatttg
ttgcggcgcatgctgtgtaaggacgtttctagaaggttctcggctgagcaagtcctcagg
catccatggattacaagtgggggagtactaggaggcggccagagctgtgggcctgtggct
gattcagcgggaatcgctatggattaa

DBGET integrated database retrieval system