KEGG   Pyrus x bretschneideri (Chinese white pear): 103932090Help
Entry
103932090         CDS       T03446                                 

Definition
(RefSeq) probable phospholipid hydroperoxide glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Pathway
pxb00480  Glutathione metabolism
pxb00590  Arachidonic acid metabolism
pxb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    103932090
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    103932090
Enzymes [BR:pxb01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     103932090
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 103932090
NCBI-ProteinID: XP_009339916
Position
Unknown
AA seq 237 aa AA seqDB search
MLCICKSTRFLFRRKLTVAASSASQRLQKHFSADSLQTLLPRSRISLFSPSIKVEFSSPV
ASTLLLNRTMAGQSESKSIHDFTVKDAKGNDVDLSTYKGKVLLIVNVASQCGLTNSNYTE
LAQLYEKYKTQGLEILAFPCNQFGAQEPGTNDEIVEFACTRFKAEYPIFDKVDVNGDKAA
PIYKFLKSSKGGLFGDGIKWNFSKFLVDKEGKVVDRYAPTTSPLSIEKDVKKLLGVA
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgctctgcatctgcaaatctactcgttttctcttccgacgaaaactcaccgttgccgct
tcatctgcttctcagcgtctgcaaaagcacttctccgccgattccttgcagacccttttg
ccacggtcgcggatttctctgttttcgccgtctatcaaggtcgagttttcaagcccggtt
gcatctactttgctgttgaatcgtacaatggctggccagtccgagagtaaatcaatccat
gacttcactgtcaaggatgccaagggtaatgatgttgatctcagcacctacaaggggaag
gtccttctgatcgttaacgttgcgtcgcaatgtggcttgactaattcaaactacacagag
ttggctcagttgtatgagaaatacaaaactcaaggtttggaaatcttggcattcccatgc
aaccagtttggagctcaggagccagggacaaatgacgagattgtcgagtttgcctgcact
cgcttcaaggctgagtatcccatctttgacaaggtggatgtgaatggtgacaaagccgct
ccgatttacaaattcttgaagtcgagcaagggtggactgtttggtgacggcatcaagtgg
aacttctccaagttcctggttgacaaagaagggaaagtcgttgaccgttatgcccctaca
acttctcctctgagcattgagaaggacgtgaagaaactgctgggggtcgcatga

DBGET integrated database retrieval system