KEGG   Pyrus x bretschneideri (Chinese white pear): 103932673Help
Entry
103932673         CDS       T03446                                 

Definition
(RefSeq) beta-fructofuranosidase, soluble isoenzyme I-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Pathway
pxb00052  Galactose metabolism
pxb00500  Starch and sucrose metabolism
pxb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pxb00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    103932673
   00500 Starch and sucrose metabolism
    103932673
Enzymes [BR:pxb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     103932673
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF3357
Motif
Other DBs
NCBI-GeneID: 103932673
NCBI-ProteinID: XP_009340588
Position
Unknown
AA seq 645 aa AA seqDB search
MDSNNTSYIPLPGEDPSAAVPPPTHRRPFKVFAVTFSSVIFLLSLVTLIIHQGPGAPRKT
VPEQPDHDHRHQQPAASTSPEPRSFSVPRGKLEGVSAKSNPYFSEEASYNWTNAMFSWQR
TAFHFQPADNWMNDPNGPLFYKGWYHLFYQYNPDSAVWGNITWGHAVSTDMIHWLYLPLA
MVPDRWFDANGVWTGSATILPNGDIMILYTGSTNDSVQVQTLAYPANLSDPLLLDWIKYE
GNPVLTPPSGIGSTDFRDPTTAWIGPDGKWRITIGSKINTTGISMVYTTTDFVNYELYDG
VLHEVPGTGMWECVDFYPVSINGTKGLETSVNNDGVKHVLKASLDDTKLDHYAIGTYFIE
NETWVPDDPTIDVGIGLRYDYGRYYASKTFYDQNKERRILWGWINETDTETDDLEKGWSS
LQTIPRTVLFDSKTGTNLLQWPVEEIEDLRLNSTEFTDVLVEAGTTVPLDIGTATQLDIF
VDFEIELLDTESVNGSSGCGDGAADRSTFGPFGILALADETLSELTPVYFRVTNSTDGDV
TTYFCADESRSSEAPEVFKHVYGGEVPVLDGETYSARVLVDHSIVESYAQGGRTVISSRV
YPTEAIYGAARLFLFNNATGVNVKATLKIWQLNSAFIHPFPLDQV
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atggactccaacaacacttcctacattcccttgccgggagaagacccctccgccgccgtc
cctccgccgactcatcgcagaccctttaaggtttttgccgtcacgttctcctcggtcata
ttcctcttgtcattggtcacattaataatccaccaaggaccgggagcgccacgaaagaca
gtgccagaacaaccagatcacgaccaccgccaccagcagccggcagcttcaactagtcca
gaaccgaggtcgttctcagtgcctaggggaaaattagaaggcgtatcggccaaatcgaat
ccatatttttcagaggaagcttcgtataactggacgaatgctatgttttcttggcaaaga
actgccttccatttccaaccggcagacaattggatgaatgatcctaatggtccattgttt
tacaagggatggtatcacctgttctaccagtacaatccggactcagccgtgtggggaaac
atcacatggggccatgcagtatcaacggacatgattcactggctctacctcccgctcgcc
atggtccccgatcgatggttcgatgcgaacggggtgtggaccgggtccgccaccatactc
cctaacggcgatatcatgattctgtacaccggaagcaccaacgattccgtgcaagtacaa
accctcgcctaccccgccaacctatcggatcccctcctccttgattggatcaagtacgag
ggtaacccggttttgactccgccatcgggaatcggatccacggattttcgtgaccccaca
accgcgtggatcggtcccgatggcaaatggcgaattaccattggatcaaaaatcaacaca
accggcatttcaatggtgtacaccacaactgattttgtaaactatgagctctatgatggg
gtcttgcatgaggtcccgggtacgggcatgtgggagtgcgtggacttttacccggtttct
ataaacgggaccaagggtttggaaacgtccgtaaataacgacggagttaagcacgtgcta
aaggctagtttggatgacacaaaattggaccactacgcaattggaacttactttatagag
aatgagacatgggtacccgatgacccgactatcgacgtcggtatcgggttgaggtacgac
tatggaaggtactatgcatcaaagacattttacgatcaaaataaggagagaaggatcttg
tggggttggattaatgaaactgatactgaaactgatgatttggagaaagggtggtcctcg
cttcagaccattccaaggactgtgttgttcgatagcaaaactggaaccaatttgcttcaa
tggccagtggaggagattgaagacttgagattaaacagtaccgaatttactgatgttttg
gttgaagcaggaacaaccgtgccacttgatattggaactgctacacaattggacatattc
gtcgactttgaaattgaattattggatacagagagtgtgaatgggagttcagggtgtggt
gatggtgctgcagataggagcacattcggaccctttggcattttggctcttgcggatgaa
actctttccgagttaaccccggtttatttccgagttaccaactcgaccgatggggacgtc
acaacttacttctgcgctgacgaatcgaggtcctccgaggctcctgaagtcttcaaacac
gtttatggaggcgaagttcctgtgttggatggtgaaacatattctgctagagtattggtt
gatcattcgattgtggaaagctacgcgcaagggggcaggacggtaatttcatcgcgggtt
tacccaacggaagcaatctatggagcagcaaggctatttttgttcaataatgcaacagga
gtgaatgtcaaggctaccctcaagatctggcagctcaactcagccttcattcatccattc
ccattagaccaggtttaa

DBGET integrated database retrieval system