KEGG   Pyrus x bretschneideri (Chinese white pear): 103933391Help
Entry
103933391         CDS       T03446                                 

Definition
(RefSeq) non-lysosomal glucosylceramidase-like isoform X1
  KO
K17108  non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Pathway
pxb00511  Other glycan degradation
pxb00600  Sphingolipid metabolism
pxb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    103933391
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    103933391
Enzymes [BR:pxb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     103933391
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF608 Glyco_hydr_116N EF-hand_5
Motif
Other DBs
NCBI-GeneID: 103933391
NCBI-ProteinID: XP_009341354
Position
Unknown
AA seq 968 aa AA seqDB search
MEKGIFLLPTYRGNMPEKKILENGFAERDYEHSDSSLEKVDPGKPASLTWQRKLNSKGSA
PLPFTLSLKEIIHLAPIGIRLWRHIREEAANEREGFIDPFAKRSLTSSHGVPLGGIGAGS
IGRSYSGDFQRWQLFPGRCEEKPVLADQFSVFVSRTNGEKYSTVLCPRSPDDLKESQVSG
IGSWDWNLKGDNSTYHALFPRAWSVYDGEPDPALKIVCRQISPFIPHNYKESSLPVSVFT
YTLYNSGKTSADVTLLFTWANSVGGLSGISGHHSNSRALMKDGVHGVLLHHKYRTANGLS
PVTFAIAAQETDGVHVSECPCFVISGDSKGVTAKDMWSEIKEHGSFDRLNSAEMPLPSEP
GSSIGAAIAASVAVPSGEVRTVTFSLAWDCPEAKFRGGKAYHRRYTKFYGTHGEAAANIA
HDAILEHRHWESQIEAWQRPVLEDKRLPEWYPVTLFNELYFLNSGGTVWTDGSPPVHSLR
SIIERKFSLDKSSLGLKSIIDAPEQNDTAIDILGRMTSTLEQVHTPIAANSAFGTNLLQE
GEENIGQFLYLEGIEYQMWNTYDVHFYSSFALVMLFPKLQLSIQRDFAAAVMIHDPSKMR
LLCDGRWVQRKVLGAVPHDIGLHDPWFEVNAYNLYNTDRWKDLNPKFVLQVYRDVVATGD
KKFAEAVWPAVYVAMAYMEQFDKDGDGMIENDGFPDQTYDTWSVYGVSAYSGGLWVAALQ
AASGMAREVGDKGSEVYFWQKFQKAKAVYAKLWNGSYFNYDNSGQASSSSIQADQLAGQW
YARACGLLPIVDEDKARSALEKIYNYNVLKFEDGRRGAVNGMLPNGKVDMSTLQSREIWS
GVTYAVAASMIQEDAIDMGFHTAEGIYEAGWSKEGLGYSFQTPEAWTTSGEYRSLAYMRP
LAIWSMQWALTKPPLFKQETELEVDEVILLRHKAGFSKVAQLLKLPPEESSRSILQTVFD
YTCKRMWL
NT seq 2907 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagggcatttttttgttaccaacttatcgaggaaacatgcctgagaagaagata
ctggagaatgggtttgctgaaagagattacgagcattcggattcttcacttgaaaaggtc
gaccctgggaagcctgcatcactgacatggcaacgaaaattaaacagcaagggcagtgca
cctttgccattcactctaagtttaaaagagataattcatttggctccaataggtattcgc
ctatggcgtcatatacgagaagaagctgctaacgaaagggagggcttcattgatccattt
gccaagcgttctctaacatctagtcatggtgtcccacttggtggtattggggcaggaagc
atcgggagaagttacagtggtgattttcagcggtggcagctgttccctggaagatgtgaa
gagaaacctgttttagcagatcaattttctgtatttgtttcccgcaccaatggtgaaaaa
tattctactgtgctttgtccgaggagcccagatgatctgaaagaaagtcaagtttcaggg
attggatcttgggactggaatctgaaaggggataattctacgtatcatgccctttttcca
agggcttggtctgtttatgacggggaacctgacccagctctcaaaatagtctgtcgtcaa
atttcaccttttattccccataattacaaggagagcagcctacctgtttcagtttttact
tatacgctatataattctgggaagacttcagctgatgtcacactgcttttcacctgggca
aattctgttggagggctttctggaatttctggtcatcactccaattcaagagcattgatg
aaggatggcgtgcatggcgtacttctacatcacaaatacaggactgcaaatgggctgtcc
ccagtgacatttgcaatagcagcacaggagactgatggtgttcacgtatcagagtgccct
tgctttgtgatatctggtgactcaaagggtgtcacagctaaggacatgtggagtgagata
aaagagcatggatcctttgatcgtcttaattctgcagaaatgccattaccttcagaaccc
ggatcatctattggggcagccattgctgcgtctgtggcagttccatctggtgaagtacgt
actgtaacattttcattggcatgggattgcccagaagcaaaatttaggggtgggaaggcg
tatcacaggcggtacactaaattttatggaacacatggggaagctgctgcaaatattgct
catgatgccattcttgagcatcgccattgggaatcccagattgaagcatggcaaagacca
gttcttgaggacaagagacttccagaatggtaccctgtcactctgttcaatgagctatac
tttctaaattccgggggcacagtttggacagatggatcacctccagtccatagcttaaga
agtattatagaaaggaagttttcccttgataagtcctcattaggtttgaaaagcatcatt
gatgcacccgagcaaaatgatactgctatcgacattcttggaaggatgacatcaacactt
gagcaagttcacacgcccatagcagcaaactctgcatttggaacaaatctccttcaggag
ggagaagaaaacattggtcaattcctttatcttgaaggaattgaatatcagatgtggaat
acttacgatgtccatttctactcatcttttgcactagtcatgctatttccaaaacttcaa
ctcagcatccaacgagactttgcagcagcagtaatgatacacgaccccagtaagatgaga
cttctctgtgatggaaggtgggtccaacgaaaggttctgggagctgttcctcatgatatc
ggcctccatgacccctggtttgaagtaaatgcttataacctgtataacacagataggtgg
aaagacttgaatcccaagtttgttctccaagtttacagggatgtggttgccacgggtgat
aagaagtttgcagaagccgtttggcccgctgtttatgttgcaatggcttatatggaacaa
tttgataaagatggagatggaatgatcgagaatgatggcttcccagatcagacttatgat
acgtggtcagtctatggtgtgagtgcatatagtggtgggctgtgggtagcagcattgcag
gctgcatcaggcatggcacgagaagtaggtgacaagggttcagaagtttatttttggcaa
aagtttcagaaggcaaaagccgtgtatgcgaaattatggaatggatcttactttaattat
gacaacagtggtcaagcttctagttcatcaattcaagctgatcaactggccggacaatgg
tatgccagagcatgtggtcttttgccaattgttgacgaagacaaggcacgaagtgcactg
gaaaagatttataattacaatgtcctaaagtttgaggatggaagacgaggggctgttaac
gggatgctacctaatggaaaggttgacatgtcaacattgcagtcaagagaaatatggtcc
ggagttacatacgctgtagctgcatcgatgattcaggaagatgcaattgatatgggattt
catactgcggagggaatttatgaagctggatggtccaaagaaggacttggatactctttt
cagactcctgaagcttggaccaccagcggtgaatacagatctttagcttacatgcgccct
ctggcgatttggtcaatgcagtgggctttaacaaaaccaccgttgttcaagcaggagacg
gaattagaagtggatgaagttattttgcttaggcacaaggctggattctcgaaagtggct
cagcttctaaagttgccaccagaggaatcatcaagaagtattttgcagactgttttcgat
tatacctgcaagaggatgtggctgtga

DBGET integrated database retrieval system