KEGG   Pyrus x bretschneideri (Chinese white pear): 103934531Help
Entry
103934531         CDS       T03446                                 

Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit C-like
  KO
K03252  translation initiation factor 3 subunit C
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Pathway
pxb03013  RNA transport
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    103934531
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:pxb03012]
    103934531
Translation factors [BR:pxb03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    103934531
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF-3c_N PCI Regnase_1_C
Motif
Other DBs
NCBI-GeneID: 103934531
NCBI-ProteinID: XP_009342556
Position
Unknown
AA seq 926 aa AA seqDB search
MASRFWTQPGSDSEDEESDYEEEVEPTGGETTTEPGLNPYLQANASDSEDSDDQKRVVRS
AKDKRFDELSATVHQMKNAMNINDWVSLQESFDKINKQLEKVMRVTEAVKVPTLYIKALV
LLEDFLAQALANKDAKKKMSSSNAKALNSMKQKLKKNNKQYEDLINKYRENPEQSEDDKP
PEEETDDDDDSEIEDPTDIALSGSEEPEEEEEEEEEPTEAGWQKKMSKKDKLMDKQFSKD
PSEITWDTVNKKFKEVVAARGRKGTGRFEQVEQLTFLTKVAKTPAQKLEIFFSVVSAQFD
VNPGLNGHMPINVWKKCVQNMHVILDILVKYPNITVDDMVEPDENESQKGPDYDGTIRVW
GNLVAFLERIDTEFFKSLQCIDPHTREYIERLRDEPMFLVLAQNVQEYLERVGNYKAAAK
VALRRVELIYYKPQEVYDAMRKLAEHTGESDNGEEPRAAEESRGPSSFIVVPELVPRKPT
FSESSRTMMDILVSLIYKYGDERTKARAMLCDIYHHALLDEFSTSRDLLLMSHLQDNVQQ
MDISTQILYNRAMAQLGLCAFRNGLITEAHSCLSELYSGGRVKELLAQGVSQSRYHEKTP
EQERLERRRQMPYHMHINPELLEAVHLICAMLLEVPNMAANTHDAKRRLISKTFRRLLEV
SEKQTFTGPPENVRDHVMAASRALGKGDCQKAFDVINSLDVWKLLRNREHVLEMLKAKIK
EEALRTYLFTFSSSYKTLSLEQLSTLFDLTEAQTHSIVSKMMINEELFASWDQPTRCIVF
HDIEQTRLQALAFQLTEKLAILAESNERATEARIGGGGGLDLPQRRRDNQDYGAGSVAGS
GGRWQDNMSFNQRQGGGAGRTGYNAGGRPFNQNAGGGYNRDRTGQYRGTGQNTRYQDGAY
AGSGRSARGSQDTSTRMVSLNRGLHA
NT seq 2781 nt NT seq  +upstreamnt  +downstreamnt
atggcatctcgattctggactcagcctggtagcgattctgaggatgaggaaagtgactat
gaagaggaggttgaacctacgggtggtgagactaccactgaacccggcctaaacccttac
cttcaggctaatgcaagtgatagcgaagattctgatgaccagaagcgcgttgttagatca
gcgaaagataagcgctttgatgaattgtctgcgactgtacatcaaatgaagaatgcgatg
aatataaatgactgggttagcttgcaagagagctttgacaagataaataagcagcttgag
aaggtcatgcgtgttaccgaggctgtaaaagtacctactctctacataaaagctcttgta
ttgttagaagactttctggctcaggctttggcaaacaaggatgctaagaagaagatgagt
agtagcaatgccaaggccttgaactcaatgaaacagaaactgaagaagaacaataagcaa
tacgaggacttaattaataaatatagggagaatcctgagcagagtgaagatgataagcct
ccagaagaggaaacggatgatgacgatgattctgaaattgaggatcctactgatattgca
ttgtcaggtagcgaagaaccagaggaagaagaagaagaagaggaagaaccaactgaagct
ggttggcagaagaagatgagtaagaaagataagctcatggataagcaattcagtaaggac
cctagtgaaatcacgtgggatactgttaacaagaaatttaaagaggttgtggctgctcgg
ggcaggaagggaactggaaggtttgagcaggttgagcagcttaccttcttgacaaaggtt
gctaagacccctgcacagaagctggagatatttttcagtgttgtttctgctcagtttgat
gtgaatcctggtctcaacgggcacatgcctataaatgtgtggaagaagtgtgtgcagaat
atgcacgttatacttgatattcttgtgaagtatcctaatattacggtggatgacatggta
gagcctgatgagaatgaatcccagaagggaccagattatgatgggacaattagggtttgg
ggaaacttggtggccttcttggaaaggatagatactgagttcttcaagagcttgcaatgc
attgatccccacactcgtgagtacattgaaagactcagggatgagcctatgtttttggtt
ctagctcaaaatgttcaagagtatttagaacgggttggaaattacaaagctgctgctaag
gtagccctaaggcgggtcgaacttatctattataagccacaagaagtttatgatgccatg
cgaaaattggcagagcatacaggagagagtgataatggtgaagagcctcgagcagctgag
gaaagtcgtggtccatcttcatttattgttgttcccgagctcgttcctcgaaaacccacc
ttctctgagagtagcaggactatgatggatatattggtttccctcatatacaagtatgga
gatgagaggactaaagctcgtgcaatgctttgtgatatttatcaccatgctctgctggat
gagttttccacttcccgtgacttgctgcttatgagtcacctgcaagataatgttcagcag
atggacatttcgacccagatactttataacagggccatggcacaacttggtctgtgtgca
tttcgtaatggattaattactgaagcgcatagctgcctttctgaactatattctggtgga
agagtaaaagagttgcttgcccaaggtgtatcacaaagtagatatcatgagaaaactcca
gaacaggaaaggctggagaggagacgacaaatgccttaccatatgcatatcaaccctgag
ctcctggaggcagtgcatttgatatgtgctatgctgctggaagtgcctaatatggctgca
aacacccatgatgcgaaacgcagattgatcagtaagacattccgtcggttgcttgaggtg
agtgagaagcaaacattcaccggtccccctgaaaatgttagggaccatgtaatggcagct
tccagggcccttggcaaaggtgactgccagaaggcctttgatgtcatcaattctcttgat
gtttggaagctccttaggaaccgtgagcatgttcttgagatgctcaaggctaagatcaag
gaagaagctctcaggacctatctttttaccttctcctcatcctataagactctgagcttg
gaacaactcagcacgttgtttgaccttacagaggcgcagactcatagcattgttagcaag
atgatgatcaacgaagagctctttgcaagttgggaccagccaacacgttgcattgttttc
catgacattgagcagactaggctgcaggctctagcgttccagttgactgagaagttggca
atccttgccgaaagtaatgaaagggcaacagaagcaagaataggtggtggtggtgggtta
gatctacctcaaaggcggagagacaaccaggactatggtgcgggatcagttgctgggagt
ggcggtagatggcaagataacatgtccttcaatcaaaggcaaggtggtggcgctgggcgt
acaggatacaacgctggagggagaccattcaaccaaaatgctggaggtgggtataacagg
gaccgcacgggtcaatacagagggacagggcaaaacacccgttatcaagatggtgcatat
gcaggatcagggaggtccgcaaggggttctcaggatacttcaactcgcatggtcagtcta
aatagaggacttcacgcctaa

DBGET integrated database retrieval system