KEGG   Pyrus x bretschneideri (Chinese white pear): 103935873Help
Entry
103935873         CDS       T03446                                 

Definition
(RefSeq) serine/threonine-protein kinase WNK8-like
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pxb01001]
    103935873
   01009 Protein phosphatases and associated proteins [BR:pxb01009]
    103935873
Enzymes [BR:pxb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103935873
Protein kinases [BR:pxb01001]
 Serine/threonine kinases: Other
  Wnk family
   103935873
Protein phosphatases and associated proteins [BR:pxb01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     103935873
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 103935873
NCBI-ProteinID: XP_009343963
Position
Unknown
AA seq 451 aa AA seqDB search
MDSCSGLEDAGVVEKDPTGRYLRYDEVLGRGAFKTVYKAFDEVEGVEVAWCRVNIKGVEE
VERLYSEVHLLKSLKHPNIVQFHNSWVDDENMTINMITELFTSGSLKQYRNKHKNVDMKA
IKNWARQILRGLDYLHSHNPPIIHRDLKCDNLFVNGFNGELKIGDLGLAIVMQQPTAHSI
IGTPEFMAPELYDEEYNELVDIYSFGMCMLEMVTCEYPYSECKNLAQIYKKVTSGVKPAS
LSKVDNPQIKQFIEKCLVTASMRLSAAELLKDPILATDNLNESSCDLSQLQKLFNLPEPA
SNSSVLELHGFSKNNEFRLRAGKNPDNTVSLTLRIADTCGLVRNIRFEFYLDSDTVISIA
WEMVEQLDLSHEDVSVVAELIDNSIVKLVPGWKPSSELSLADKDRYDALKRELDAIGKQY
FSKLREEEMQSAKKSWIAENKIAVIDVLYYC
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atggactcctgtagtggtttggaagatgctggcgttgtggagaaagatccgactgggaga
tacttgcggtatgacgaagtattggggaggggagcattcaagactgtatataaggcattt
gatgaagtcgaaggagtcgaagtagcttggtgccgagtgaatatcaagggagtagaagaa
gtggaaagattgtattcggaggttcatctgctgaagtcactgaaacatccaaacatcgta
cagttccataactcttgggtggatgatgagaacatgaccatcaacatgataacagagtta
ttcacttccgggagcttgaagcagtaccgaaataagcataagaatgtcgatatgaaagcc
atcaagaattgggctagacagattcttcgaggtctggactatctgcattctcataatcct
ccaattattcatagagatttgaagtgtgacaacctatttgtcaatggatttaatggagaa
ctgaaaatcggagatctcggattggcgattgtcatgcagcagcctactgctcatagcata
attggcacccctgaattcatggctccagagctttatgacgaggaatacaatgaattagtc
gacatctattcttttggcatgtgcatgctagagatggtgacttgtgaatacccttatagt
gaatgtaaaaatctggcgcaaatttataaaaaggttacctctggtgtaaagcctgcttcc
ctcagtaaagtagacaatcctcaaatcaagcagttcatagagaagtgtctagttacagct
tctatgagattgtctgcggcggaactcttgaaagatccaatccttgcaactgacaacttg
aatgagtccagctgtgatctttcacaactacaaaagttgtttaacttgccagagcccgca
tctaactcgtcagtgctggagttacatggtttctctaagaataatgagttcaggttaaga
gcggggaaaaatcccgataacacagtgtctttaactttgcgcattgctgatacatgtggt
cttgtgaggaatatcaggtttgagttctatctcgattctgatactgtgatttcaattgct
tgggagatggttgagcaacttgatctttcacatgaagatgtatctgtcgtagctgagcta
attgataactcgattgtgaagcttgtacccggatggaaaccttcatcggagttgtctcta
gcggacaaagataggtatgatgcgctaaagagggagcttgatgctattggtaagcagtat
ttctcgaaattaagggaagaggaaatgcagagtgcaaagaagagttggatagcagaaaac
aaaatagctgtaattgatgtactatactattgctaa

DBGET integrated database retrieval system