KEGG   Pyrus x bretschneideri (Chinese white pear): 103938125Help
Entry
103938125         CDS       T03446                                 

Definition
(RefSeq) transcription factor IWS1-like
  KO
K17498  transcription factor SPN1
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:pxb03021]
    103938125
Transcription machinery [BR:pxb03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     103938125
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Med26
Motif
Other DBs
NCBI-GeneID: 103938125
NCBI-ProteinID: XP_018500705
Position
Unknown
AA seq 480 aa AA seqDB search
MAYEDNPYRDEDGEPLMDYDDFGAGRDPSPEPHQDDVLEDNDDWPDQDRSRTPVHEDPSS
LKSKPRKRLIKKSQVGKLPVISDLDDDDGGDGDEGNRKRLKKEKRHKGEKKGSKYPRRSS
SDKAATDGEVKEMWETIAGGDSEDDQEGVRNYDDDNFIDDTGVHPSDRYGSDNEPRSPSH
HPQAEEGEEDDEIKDMFKMGKKRKKNEKSPAEVAFLVEKVMAELEVTAEEDADLNRQGKP
AISKLKKLPLLTKVLSKKQLQQEFLDHGVLTLLKNWLEPLPDGSLPNINIRAAILQILTD
FPIDLEQYDRREQLKKSGLGKVIMFLSKSDEETTSNRKLAKELVDKWSRPIFNKSTRFED
MRNVDDERVPFRRPTIKKPVSNGTGMESRDDVDEFSRERKSGQSSSRQHASRPEATPMDF
LVRPQSRIDPDEIRARAKQGIQDQRRMKMNRKLQQLKAPKKKQLQATKLSVEGRGMVKYL
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggcatacgaagacaatccgtaccgtgatgaagatggggagccattgatggactacgac
gactttggagctggtcgcgacccgtctcccgagccccaccaagatgacgtcctagaagat
aacgacgattggcccgaccaagaccggtctcggacccctgtccacgaggatccgtcgtcg
ttgaaatcgaagccgaggaagcggttgatcaagaagagccaagttggaaaattgcctgtg
atctctgatttggacgatgatgacggtggcgatggcgatgagggcaatcggaagaggttg
aagaaggagaagaggcataagggggagaagaaagggtctaaataccccaggagatcctca
tctgacaaggcggccaccgatggtgaggtcaaggagatgtgggaaaccatcgccggcggc
gactctgaggatgatcaagagggtgtcaggaattatgatgacgacaactttatagatgac
actggtgtgcatccttctgatcggtatggaagtgacaatgaaccacgttctcctagtcac
catcctcaggctgaagagggtgaggaagatgatgaaattaaggatatgtttaagatgggt
aagaaaaggaagaagaatgaaaaaagtcctgcagaagtagcattcctggttgagaaggtc
atggctgagctcgaagttacagcagaagaggatgcagatttaaatagacagggaaaacct
gccattagtaagctcaagaagttgcctcttcttacaaaggtcctgtcaaagaagcagctt
caacaagagtttttagatcatggagtgttaactctactgaagaattggcttgaacctctt
ccagatggaagtttaccgaacataaatatacgtgcagcaattttacagattttgactgat
ttccctatagatctagagcagtatgatagaagagaacaactgaaaaagagtggccttgga
aaggtcatcatgtttttatcaaaatctgatgaagaaacaacttccaacagaaaacttgca
aaggaattggttgacaaatggagtcgacctatatttaataaaagtacgaggtttgaggat
atgagaaacgttgacgatgagagggttccctttagaaggcctacaattaaaaagccagtg
agtaatggcacaggaatggaatcgagagatgatgtggatgaattttcaagggaaagaaaa
tctggccaatcatcttctcggcaacatgcctcaagaccagaagcgacaccgatggacttt
ttggtgcgcccacaatccaggattgatcctgatgaaattagagcccgtgctaaacaaggg
atacaagatcagcgccgaatgaagatgaataggaagttacagcagttgaaagcaccaaag
aagaagcagcttcaggccacaaaattaagcgtggagggtcgtggtatggtcaagtatttg
tga

DBGET integrated database retrieval system