KEGG   Pyrus x bretschneideri (Chinese white pear): 103938621Help
Entry
103938621         CDS       T03446                                 

Definition
(RefSeq) probable serine/threonine-protein kinase WNK5
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pxb01001]
    103938621
   01009 Protein phosphatases and associated proteins [BR:pxb01009]
    103938621
Enzymes [BR:pxb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103938621
Protein kinases [BR:pxb01001]
 Serine/threonine kinases: Other
  Wnk family
   103938621
Protein phosphatases and associated proteins [BR:pxb01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     103938621
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C
Motif
Other DBs
NCBI-GeneID: 103938621
NCBI-ProteinID: XP_009346923
Position
Unknown
AA seq 603 aa AA seqDB search
MNKNNSRIGSRSAMGGRPQSPAYVETDPSGRYGRFREMLGKGAMKTVYKAFDEVLGMEVA
WNQVKLNDAFSSPDELQRLYSEVHLLKNLHHDSIIQYYKSWIDVNRRTFNFITEMFTSGT
LREYRHKYQRVNIGAVKNWSRQILRGLAYLHKRDPPVIHRDLKCDNIFVNGHLGQVKIGD
LGLAAILRGTQHAHSVIGTPEFMAPELYDEEYNELVDIYAFGMCVLEMLTSEYPYSECSN
PAQIYKKVTSGKLPNAFYKIEDLEAQRFVGKCLENVSKRLPAHELLLDPFLAFDDGELAS
PPRISIPELIPNNDPVAEAGDGEDELHFSAEVDLERSTNMIITGKMNPEDDTISLKVRIS
DLDGKNARNIYFPFDIMNDTAIDVATEMVKELEISEWEPPEIAGMIEKEIFSLIPGRTKW
GSPHGYHPHQHSFNYEEEDDDDGGVNHHPFYSFSLCSSSQNSLHSFRSHCKNHHLLHGDL
FMNDDVSSQSSFDSCNYSNINYYSGNEDDLHDVSFGKATHKSTRFCPSESRGANSYKQCN
SQLDNQRPHKLNHHQERKLPKIQSLIDVRSQLLHRSLVEEVNKRRLFKTVGTIENVGFQT
PGS
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaaacaacagccggatcggaagcaggtctgccatgggaggcaggccacagtca
cctgcatacgttgaaacagatccatcaggtcgatatggacgtttcagggaaatgcttggc
aaaggagccatgaagacagtttacaaggcatttgatgaggtcctcggaatggaggtggcg
tggaatcaagtcaagcttaatgatgccttcagttcgccggacgaacttcagcgcctatac
tccgaggtccacctcctcaagaacctgcaccatgactccatcatccaatactacaagtcg
tggatcgatgttaatcgtcgaaccttcaacttcatcaccgaaatgttcacctccggcact
ctcagagagtacagacataagtaccagcgagtgaatattggtgcagtgaaaaattggtcc
cggcagatcttacgtggtctggcttatttgcacaaacgtgatccgcctgtgattcacaga
gacctcaagtgtgacaacatctttgttaatggccatctagggcaagtcaagattggtgat
ttgggcttggctgctattcttcgtggtacacaacacgcccacagtgtcataggtacacca
gaatttatggcgcctgaattgtatgatgaggaatacaatgagctagtagacatatatgcc
tttggcatgtgtgtgttggaaatgcttacttcagaatatccctatagcgagtgctcaaat
cctgcccaaatttacaagaaagttacttcagggaagctaccaaacgcattctacaagatc
gaagatttggaggctcaacgatttgtcgggaagtgtctggagaatgtttcaaagaggtta
ccggcacacgagctattgctagacccttttctagcctttgatgatggagagctagcgtcc
cctccaagaatctcaattcccgagttaattcctaataatgatccagtggcggaggcgggg
gacggggaggatgagctacatttttccgctgaggttgatttggaaagaagcacaaacatg
atcatcaccggaaaaatgaatccagaggatgataccatttctctcaaagttcggatttct
gacctggacgggaaaaatgctaggaacatatactttccctttgacatcatgaacgacact
gcaattgatgtagcgacggagatggtgaaagaattagaaatcagtgaatgggaaccacca
gagattgcagggatgatagaaaaggagatattttctttgattccgggtcgcacgaaatgg
ggctcaccccatggttatcatcctcatcagcacagctttaactatgaagaagaggatgac
gatgatggtggtgtcaaccatcatcctttctactcattctctttgtgctcttcgtcccaa
aattctcttcattctttcagatctcactgcaagaatcatcatttgcttcacggtgatttg
tttatgaatgatgatgtaagttctcagagttcattcgactcctgcaactactccaacata
aattactactcaggcaatgaagatgatctccatgacgtgagcttcggaaaggctactcat
aaatctactcggttttgtccttcagaaagcaggggtgcaaattcttacaaacaatgcaat
tcacaactagataaccagagacctcacaaattgaatcatcatcaggaaaggaaattaccc
aagattcaatcactcatcgacgtgcgcagtcaattgttgcaccggtcactggtggaggag
gtaaacaagaggcggttgtttaagactgttgggacaattgagaacgttggttttcaaaca
ccaggaagctag

DBGET integrated database retrieval system