KEGG   Pyrus x bretschneideri (Chinese white pear): 103941918Help
Entry
103941918         CDS       T03446                                 

Definition
(RefSeq) amidase 1-like
  KO
K01426  amidase [EC:3.5.1.4]
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Pathway
pxb00330  Arginine and proline metabolism
pxb00360  Phenylalanine metabolism
pxb00380  Tryptophan metabolism
pxb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    103941918
   00360 Phenylalanine metabolism
    103941918
   00380 Tryptophan metabolism
    103941918
Enzymes [BR:pxb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     103941918
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-GeneID: 103941918
NCBI-ProteinID: XP_009350394
Position
Unknown
AA seq 428 aa AA seqDB search
MAIDSDHGAFVEKFLLQPPSSSHDLPLSGLTFAVKDIFDVAGRVTGFGNPDWARTHPAAE
STAPAVSAILNGGATSIGITVMDEMACCMNGENKHYGTPRNPCAPDRVPGGSSSGSAVVV
AAGLADFSLGTDTGGSVRVPASHCGIFGFRPSHGVISTSGVTPLAQSFDTVGWFARNPAI
LNRVGRVLLQLPDTGPVVPTQLIIAEDCFQISSVPSSRVKQALVDSVEKLFGGHVIKHAI
LGDVVKDKVPSLNSFLDKGNPSEEYIIPSLAALSTAFHLLGSYEFKSNHGEWVSTVRPDL
GPGIAERVWAIVRSTDENVDVCHSVMTELHAALTDLLGDFGVLAMPTVLGDPPKLQTDPT
TLDGFRARAFSFLSIAVVSGFCQVSIPLGMCDNLPVSVSLMAKHGSDGFLLNLVETLYDT
LKEHVGKL
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggcgattgactcagatcatggagctttcgtggagaaatttcttcttcaaccgccgtct
tcgtcacatgaccttcctctgagcggcctcacctttgctgttaaagacatatttgatgtg
gctggacgtgtgactgggtttgggaatcctgattgggcgaggactcacccggctgctgaa
tcaacagctccggctgtttcggcaatattgaatggaggtgccacaagtattggtataact
gtcatggatgaaatggcatgctgtatgaatggagagaacaagcattacggcacacccaga
aatccgtgcgcaccagatagggtgcctggaggctcttctagcggttctgctgttgtcgta
gctgcaggcctcgcagatttttccttaggaaccgatactggaggaagtgtaagagtacct
gcttcgcattgtggaatttttgggtttcggccatctcatggtgtcatttctacttctgga
gttactcctctggcacaaagtttcgatacagtgggatggtttgcaaggaatcctgcgatt
ttgaatagagttggacgagtgctactccaattacctgatacgggtcctgtcgtacccact
cagttaatcatcgcagaagactgtttccagatttcaagtgttccaagcagtcgagtgaaa
caagcacttgttgactcagttgagaagttatttgggggtcatgttataaaacatgctatt
ctcggggacgttgtcaaggacaaagttccaagcttgaactctttcttggataaaggaaat
ccaagtgaagagtacattataccgtcattggcagccctatcaaccgcctttcatcttctc
ggaagttatgaattcaagagcaaccatggtgaatgggttagtacagtcagacctgactta
ggccccgggatagcagaacgtgtatgggcaattgttcggtcaacagatgaaaatgtcgat
gtttgtcactccgtgatgactgaactgcatgctgctcttactgaccttctcggggatttc
ggtgtcctcgcaatgcctacagttctaggggatccaccaaagctgcaaacagatcctact
acactggacggttttcgtgccagggctttcagcttcctatccattgctgtagtttccgga
ttctgccaggtgagtataccactagggatgtgcgataacctacctgtttcagtttccttg
atggcaaagcatggttcggatgggttcctgctcaatcttgtcgagactctttacgacact
ctcaaagaacacgtcgggaagctgtga

DBGET integrated database retrieval system