KEGG   Pyrus x bretschneideri (Chinese white pear): 103942695Help
Entry
103942695         CDS       T03446                                 

Definition
(RefSeq) histidine decarboxylase-like
  KO
K01590  histidine decarboxylase [EC:4.1.1.22]
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Pathway
pxb00340  Histidine metabolism
pxb01100  Metabolic pathways
pxb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    103942695
Enzymes [BR:pxb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.22  histidine decarboxylase
     103942695
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_1_2 Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-GeneID: 103942695
NCBI-ProteinID: XP_009351156
Position
Unknown
AA seq 276 aa AA seqDB search
MVHMRYIESDYKQSMRGDKLEEAIISDKAQGMIPFWVCATLGTTGTVAFDELREVGNVCQ
KYGSWLHVDAAYAGSAFICPEYRHWLDGVELADSFAFAPSKWFMVTFDCTAMWVKDTAGL
QRSFNVNPLYLRHENEGKAIDYMHWQIPLSRRFRALKLWFVLRNFGISGIQEHIRTCIQR
AQQFESLVLSDNKFEVPQSRVLSLVVFRLKGDNSHSERLLKVINSRGKIHVVPSSFKNKY
VIRFCVISPKTTSQDILGENLSSLWQTRIVYFITDE
NT seq 833 nt NT seq  +upstreamnt  +downstreamnt
ggatggtgcacatgaggtacatagagtccgactacaaacagagcatgcggggggacaaac
tggaggaagccatcatcagtgataaagcccaaggaatgatcccattctgggtgtgtgcca
ccctgggcacgacaggaaccgttgcgttcgatgagctacgggaggtgggcaacgtgtgtc
agaagtacggttcttggctacatgtggacgcggcgtatgctggcagcgcctttatatgtc
cggagtatcggcattggctggatggagtggagttggcagattcctttgcttttgctccct
cgaagtggttcatggtgacctttgactgcacagccatgtgggtcaaagacaccgccggtc
tacagaggagcttcaatgtgaacccactttatctaaggcatgagaatgaagggaaggcta
ttgactacatgcactggcaaatacccctgagtcgtcgcttcagagccctgaagctgtggt
tcgtgctgagaaacttcggtatttctggaatacaggagcatattcgaacgtgcattcagc
gtgcccaacagtttgaaagcctcgttctatcagacaacaaattcgaggtccctcaatcca
gggtcttaagtctagtagtattccgtctgaagggagacaacagccactcggagcgcctgc
tgaaggtcatcaactcgcgcggcaagatccacgtggtgccgtccagcttcaagaacaaat
acgtcatcaggttctgtgtcatctcgccgaagaccacgagccaggatatcttgggtgaga
acttgtcatcattgtggcagactcgtatagtatattttataacagacgagtag

DBGET integrated database retrieval system