KEGG   Pyrus x bretschneideri (Chinese white pear): 103942929Help
Entry
103942929         CDS       T03446                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: separin-like
  KO
K02365  separase [EC:3.4.22.49]
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pxb01002]
    103942929
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pxb03036]
    103942929
Enzymes [BR:pxb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.49  separase
     103942929
Peptidases [BR:pxb01002]
 Cysteine Peptidases
  Family C50: separase family
   103942929
Chromosome and associated proteins [BR:pxb03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   Separase
    103942929
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPR_12 TPR_2 RPN7 TPR_14 TPR_8 TPR_21 TPR_1 TPR_11 TPR_MalT
Motif
Other DBs
NCBI-GeneID: 103942929
NCBI-ProteinID: XP_009351401
Position
Unknown
AA seq 861 aa AA seqDB search
FEAIMETIRSDNLQPATSSKSPLSSIYQVLGSTAHAARHYDDAHGWLQSLRSCLCPETDS
FVRICSVSAWILAAALRQASPDSDVEQLVGDVVAGLEGSLSGTVSELNELLEGLSAARRA
VVGLLKKVLDPGPTAKPVSENLVAVSENLVAVSKDFILRFPRFVRRWLGSPPGKEAGTKQ
VLQFDQRRQTVMQSMGQVLDAALMVLKCDIQAGSSEWQLTDDVLQHCAALLESVSDPAMS
AARAEQLGVYHVKISSLYFSNFLELRKLPQRSKDTNKRLLQALSRSIDAVKDRPLAEREK
AQLSTKLELFADLCREMGRGEDAVRTLRSICTGMAEDGVLSDVAVALATHPPALAWAMTE
KASSLSRTLRSIAKLDRSCHDWTFFLPETERLAALLRIYVPEKYPIRRLRVLLHISYQNI
GEEAGLDELETQLDQALQQCQRKDKADDAALCPFVPHXXXXYHGLVSAMADSGTELPLLA
VRNSISSWKTMSEACQTRDDLYAVIDNPEGLLDQLLSLSQLAGLRGDNALQLSISELSVT
LAQAIGAGLLAVGSARDGLVLCHSQLATRYVSIGSYTQAMETLERTRLLVEQHEGISRGI
VADFYLSQAEYHSGIGAFEESLKCISKANDICSQSYSTWAQSKSQAMVTLSMASFLQSTV
SLKRGDVQDALAAVKSSVRMLSHDWSKLEAEVSAKGVGSAETSMSEASSVSIQVKSSRSR
ASGPRFWRLASPLLRSLLHISSVYGHVGMFQETIYYAESARKVAESTQSPLFMAQVSAWM
GSVYVKAGMRDEALAAYEEATKHMPQDACSCRVRVAGQVGDFYNTMGDEDKARRYLQIAE
DTIHQLGRIGQAAAIASKECE
NT seq 2583 nt NT seq  +upstreamnt  +downstreamnt
tttgaagccatcatggaaaccattcgctctgacaatcttcagcccgcgacatcgtccaag
tctccattatcttccatctaccaggttctcggatcgacagcgcacgcggcgcggcattat
gacgacgcccatggctggctccagagcctcaggagctgcctgtgccccgagaccgactcc
tttgttcgcatttgctccgtatcggcttggatcctggccgcggccctcagacaggcgagt
ccggactcggatgttgagcagctcgtaggcgacgttgttgccggtctagagggaagcctc
agcggaaccgtctcggagcttaacgagctcctcgagggtctttcggccgccagacgcgcc
gtcgtcggacttctcaagaaggtcctggaccctggaccgacggcaaagcccgtctcggag
aaccttgtcgccgtctcggaaaaccttgtcgccgtctcaaaggactttatcctgcgattc
ccgcgattcgtacgccggtggctagggtctcccccgggcaaagaggccggaacgaagcag
gtgctccagttcgaccagcggagacagacggtgatgcagtcgatgggtcaggtcctggat
gcggccttgatggttctcaaatgcgatatccaggctggctcgagcgagtggcagctcacc
gacgacgttctgcagcactgcgcggcactgctcgagtccgtctccgaccctgccatgtcg
gcggccagggcggagcagctgggcgtatatcacgtcaaaatctcgagcctctacttctcc
aacttcctggagctacgcaaattgccccaacgatccaaggacaccaacaaacggcttctt
caggccctcagccggtccatcgacgcggtcaaggacaggccgctcgccgaacgggaaaag
gcccagctgtcgaccaagctggagctgtttgcggacctctgccgggaaatgggaagaggc
gaagatgccgtccgcacgctgcggtccatctgcaccggcatggccgaggacggcgtcttg
tcggacgtggcggtggccctggcgacgcatcctcccgccctggcgtgggccatgacggaa
aaggcctcgtcgctgtctcggaccctgcgctcgatagcgaagctggaccgctcgtgccac
gattggacctttttcttgcccgagacggagcggctcgctgcgctgttgcgcatctatgtc
ccggaaaagtatcccatacgccggctgcgcgttcttcttcacatttcctatcagaacatc
ggcgaggaggccggcctggatgagctcgagacccagctcgaccaggccttgcagcagtgt
cagcgcaaggacaaggcagacgacgccgcgctctgtccttttgtcccacacnnnnnnnnn
ncctaccatggcttggtatcggcaatggccgacagcgggacggagctccccctcttggcc
gtcagaaactcgatatcctcctggaagaccatgtcggaggcatgccagacgagggacgac
ctgtacgccgtcatcgacaacccggaaggcctgctggaccagctcctgtcgctgagccag
ctcgcgggcctccgaggcgacaatgcgctgcagctctccatctcggagctctccgtcacc
ctggcccaggccattggcgccgggcttttggccgtaggatcggctcgcgatggcttggtc
ctctgccacagccagctggctacgcgatacgtcagcatcggcagctacacgcaggccatg
gagacgctggagcgcaccaggctgcttgtcgagcaacacgagggcatctcgcgcggcatc
gttgccgacttttacctttcgcaggcagagtaccatagcggaatcggggcctttgaagaa
tccctgaaatgcatctcgaaagcaaacgacatttgcagccagtcgtactcgacgtgggcc
cagtcaaagtcgcaggcaatggtgacgctatccatggcatctttcctgcagtcgaccgtc
tccctgaagaggggagacgtgcaggatgccctcgcagccgtcaagtcgagtgtccggatg
ctgtcccacgactggtcgaagctcgaggccgaggtgtcggccaagggcgtcggcagcgcc
gagacgagcatgtcggaagccagctcggtcagcatccaggtgaagtcgtctcggagcagg
gcaagcggccctcggttctggcgcctcgcctcgcccctcctccgcagcctgctgcacatt
tcttcggtatacggccacgtgggcatgttccaggagaccatctactacgccgagtcggca
cgcaaggttgccgagagcacgcagtcgccgctcttcatggcacaggtgtcggcctggatg
ggctccgtctacgtcaaggcgggcatgcgggacgaggccctcgcggcgtacgaggaagcg
accaagcacatgccacaggacgcgtgctcgtgccgtgtgcgagtcgcgggccaagttggc
gatttctacaacaccatgggcgacgaggacaaggcacgcagatatctccaaattgccgag
gacacgattcaccagctgggccgcatcggccaggctgctgcgattgcgtccaaggaatgc
gag

DBGET integrated database retrieval system