KEGG   Pyrus x bretschneideri (Chinese white pear): 103945307Help
Entry
103945307         CDS       T03446                                 

Definition
(RefSeq) probable inactive receptor-like protein kinase At3g56050 isoform X1
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase LRRNT_2 LRR_8 LRR_4 LRR_1
Motif
Other DBs
NCBI-GeneID: 103945307
NCBI-ProteinID: XP_018502528
Position
Unknown
AA seq 746 aa AA seqDB search
MDQRWRVSGFSQHRRIPVVAVVFLLLFHQNLSPCWSLNIEGLALLRFRDRVVTDPFGALS
NWNNNGGEDDHCSWFGVECSDGKVVILNLRDLCLGGTLAPDLGKLAYIKSIILRNNSFTG
NIPREIAELMKLEVLDLGYNNFTGPFPSDFSNNPSLTTLYAHLFRTVWDHESYSLMASTI
LLNSSCVFYCSLLDNNRFLGSISSELHQLKMLLECQVDQDQRLTDAAFCTSRSISWSTAK
PEDATHRRLQQVADDKAPSRFRRAKENERGSLPTSASSSSSPPLHQPSLPPSQPFSVSLP
PSTFSSSLSLDSPLPSPSPSPSSSPSASPSSSFPAPSPSPWVAPTPASPVPRNPPTTIFA
PPESSPEPIPSPSSSLSQVAQSNSNSRHRVVIICAGIVGGCLLIFLSVVGIIVARSSKVV
TVKPWATGLSGQLQKAFVTGVPKLNRSELEAACEDFSNVIGSLSDGNVYKGTLSSGVEIA
VTSITTESAAGWTKSLEAQFRKKIETLSKVNHKNFVNLIGFCKEEKPFTRIMVFEYAPNG
TLFEHLHIKEAEHLDWGMRLRIAMGMAYCLEYMHQLKPPVVQKNLQSSSVYLTEDYAAKI
SDFTFLSGVTTAKMGSVDKKLHDSMSTDPESNVYSFGVILFEMITGRIPYSVENGSLEDW
ASHYLKGDKSLREIVDPTLNSFQEEELSELFRVIKDCVHPDRKQRPTMTEIAGRLREITA
MGPDGATPKLSPLWWAELEIMSTEGN
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atggatcaaaggtggagagtttctgggttttctcagcaccgccggattccggtggtagcg
gtggtgtttcttttactgtttcatcagaatctaagcccgtgctggtctcttaacattgaa
ggtttggcgttgttgaggttcagggacagggtggtgacagacccctttggggctttatcg
aattggaacaacaacggtggagaagatgatcattgttcctggttcggggtggagtgctcg
gatggaaaagtggtcatcttgaatttgagagatctttgtcttggaggaacgttggctcct
gatttagggaagctggcttacataaaatctatcattttacgcaataattcgtttactgga
aacattccgagggagatcgcagagctaatgaagctggaggttttggacctgggatacaat
aactttactggacctttcccatctgatttcagcaacaatccgtctcttactactctgtac
gcacatctttttcgaactgtttgggatcacgagtcttattctctaatggcttccacaatt
ttactaaactcatcttgtgttttttattgcagtttacttgacaataacagatttcttggt
tccatatcttctgaactccaccaattgaagatgcttttggaatgtcaggtagatcaggat
caacgactaacagatgccgctttctgtacgagcagatctatcagctggagcactgccaaa
cctgaagatgcaactcaccgtaggctgcagcaggtggcagatgacaaagcaccgtccaga
ttcagaagggctaaagaaaatgaacgcggttcattaccaacttctgcttcttcatcttcc
tcaccaccgcttcatcagccttctttaccaccttcacagccattttcagtctcattgcca
ccatcaacattttcatcttcactgtcattagattcccctttaccatcaccatcaccatca
ccatcatcttctccttctgcatctccctcaagtagttttccggctccttcaccctcaccc
tgggtagcgccaactcccgcctctccagtcccaagaaatccaccaacaactatttttgca
ccaccagagtccagtccagaaccaattccttccccttcttcaagtctaagtcaagtggct
caaagcaattccaattcaaggcatcgtgtagttattatatgcgcaggcattgttgggggt
tgtttattgattttcctttcggttgttggcattattgtcgccagaagcagtaaagttgtt
actgtcaagccctgggccactgggttaagcgggcagttgcagaaagcatttgtaacaggt
gtaccaaagctgaaccgatcagaacttgaggcagcttgtgaagatttcagtaatgtaatt
ggatctctctcagacggcaacgtttataaaggaactctttcaagtggggtagaaatagct
gtgacatcgatcacaacggaatctgctgcaggctggactaaaagtttggaggctcagttc
agaaagaagatagaaacattgtccaaagtaaaccacaagaactttgtaaatcttatcggg
ttttgcaaagaagagaaaccattcacaagaataatggtttttgagtatgctccaaatgga
acgctttttgagcatctacacataaaagaagcagagcacttggactggggaatgcgacta
cgaatagccatgggcatggcatactgtctagagtacatgcaccaactgaaaccacctgta
gttcagaagaacttgcaatcatcctctgtatacctgaccgaagactacgcagccaaaata
tccgattttaccttcttgagtggagtgacaacagcgaagatgggatccgttgacaagaag
cttcacgattccatgtccacagatccagaaagcaatgtctacagcttcggggtaatattg
tttgaaatgatcaccggtaggattccatactccgtggaaaacggttctcttgaagactgg
gcgtcccactatctgaagggagataaatccttgagagaaatagtggatcctaccctaaac
tctttccaagaagaagagctaagcgaactgtttcgagtgataaaagactgcgtccatcct
gaccggaaacaaagaccgactatgacagagatcgcgggtaggttaagggaaatcacagcc
atggggcctgacggagccacaccgaaactatcacctctttggtgggcagaacttgaaatt
atgtcaacagaaggaaactga

DBGET integrated database retrieval system