KEGG   Pyrus x bretschneideri (Chinese white pear): 103945335Help
Entry
103945335         CDS       T03446                                 

Definition
(RefSeq) fructose-1,6-bisphosphatase, cytosolic-like
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Pathway
pxb00010  Glycolysis / Gluconeogenesis
pxb00030  Pentose phosphate pathway
pxb00051  Fructose and mannose metabolism
pxb00710  Carbon fixation in photosynthetic organisms
pxb01100  Metabolic pathways
pxb01110  Biosynthesis of secondary metabolites
pxb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103945335
   00030 Pentose phosphate pathway
    103945335
   00051 Fructose and mannose metabolism
    103945335
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    103945335
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pxb04147]
    103945335
Enzymes [BR:pxb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     103945335
Exosome [BR:pxb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103945335
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FBPase zf_CCCH_4
Motif
Other DBs
NCBI-GeneID: 103945335
NCBI-ProteinID: XP_009354169
Position
Unknown
AA seq 346 aa AA seqDB search
MDHAADAQRTDLMTITRFVLNEQSKHPEARGDFTILLNHIVLGCKFVCSSVSKAGLAKII
GLAGGTNVQGEEQKKLDVLSNQVFVKALTSSGRTCILVSEEDEEAIFVEPSKRGRYIVVF
DPLDGSSNIDCGVSIGTIFGIYVAKDKHNPSLEDVLRPGNKMVAAGYCMYGSSCTLVLST
GNGVNGFTLDPSLGEFILTHSNIKIPQKGKIYSVNEGNAQNWDEQTTKYVEKCKFPQDGS
SPKSLRYIGSMVADVHRTLLYGGMFMYPADNKSPNGKLRVLYEVFPMSYLVEQAGGQAFT
GKQRALDLVPNKIHERSPVFLGSYDDVEEIKQLYGVKNSISNGFSR
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggatcatgcggctgatgctcagagaactgatcttatgaccatcactcgttttgttctt
aacgagcagtccaagcatccggaggcgcgtggcgattttaccatcttactcaaccacatt
gttctcggttgcaaatttgtctgctcctccgttagcaaggcaggtcttgcaaaaataatt
ggacttgctggagggaccaatgttcagggtgaagagcagaagaaattggatgtgctttcg
aatcaagtttttgtgaaagcgctaactagcagtggccgtacttgcattcttgtttcggaa
gaggatgaagaggccatattcgtagagccatcaaagcgtggaagatacattgttgttttt
gacccgttggatggatcctccaacatcgattgtggtgtttctataggaactatctttggg
atttacgtggcgaaagataagcacaacccaagtcttgaggatgtactgcgacctgggaac
aagatggtagccgctggttattgcatgtatggaagctcttgcacgctggtgcttagtact
ggaaatggagtgaatggcttcacgcttgatccatcgctaggggaatttatattaactcat
tccaacattaagattccgcagaagggaaagatctactcagtaaatgaaggaaatgcacag
aactgggatgaacaaactaccaaatatgtggaaaaatgcaagttcccccaagatggttca
tctcccaagtctcttagatacattggaagcatggttgctgatgtgcaccgaacattgcta
tacggaggcatgtttatgtaccctgccgataataaaagcccaaatggaaaactacgagtt
ctttacgaagttttcccgatgtcatacctggttgagcaagcaggaggtcaagcttttact
ggaaagcaaagggccctagacttggttccaaacaagatacatgagaggtccccagtattc
cttggtagctatgacgacgttgaggaaattaaacaactgtatggggttaagaatagcatc
tccaatggcttttctagatga

DBGET integrated database retrieval system