KEGG   Pyrus x bretschneideri (Chinese white pear): 103945384Help
Entry
103945384         CDS       T03446                                 

Definition
(RefSeq) heat shock 70 kDa protein-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Pathway
pxb03040  Spliceosome
pxb04141  Protein processing in endoplasmic reticulum
pxb04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    103945384
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103945384
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103945384
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pxb01009]
    103945384
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pxb03041]
    103945384
   03009 Ribosome biogenesis [BR:pxb03009]
    103945384
   03110 Chaperones and folding catalysts [BR:pxb03110]
    103945384
   04131 Membrane trafficking [BR:pxb04131]
    103945384
   03051 Proteasome [BR:pxb03051]
    103945384
   03029 Mitochondrial biogenesis [BR:pxb03029]
    103945384
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pxb04147]
    103945384
Protein phosphatases and associated proteins [BR:pxb01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     103945384
Spliceosome [BR:pxb03041]
 Complex B
  Other components
   Prp19 complex
    103945384
 Complex C
   Prp19-CDC5 complex
    103945384
Ribosome biogenesis [BR:pxb03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    103945384
Chaperones and folding catalysts [BR:pxb03110]
 Heat shock proteins
  HSP70 / DNAK
   103945384
Membrane trafficking [BR:pxb04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    103945384
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    103945384
Proteasome [BR:pxb03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    103945384
Mitochondrial biogenesis [BR:pxb03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    103945384
Exosome [BR:pxb04147]
 Exosomal proteins
  Proteins found in most exosomes
   103945384
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DUF4795 Hydantoinase_A Radial_spoke_3
Motif
Other DBs
NCBI-GeneID: 103945384
NCBI-ProteinID: XP_009354217
Position
Unknown
AA seq 656 aa AA seqDB search
MASKTQGKAIGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
QVAMNPQNTVFDAKRLIGRRFSDPSVQSDMKHWPFKVVAGPGDKPMIVVNYKGEEKQFAA
EEISSMVLTKMREIAEAYLGHPCNNAVVTVPAYFNDSQRQATKDAGSIAGLNVMRIINEP
TAAAIAYGLDKKGSSTGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD
NRLVNHFVQEFKRKHKKDISSNARALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFY
STITRARFEEMNMDLFRKCMEPVEKCLRDSKIDKSRVDEVVLVGGSTRIPKVQQLLQDFF
NGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLI
PRNTTIPTKKEQIFSTYSDNQPGELIQVYEGERARTKDNNLLGKFELTGIPPAPRGVPQI
NVCFDIDANGILNVSAEDKTAGVKNKITITNDKGRLSKEEIERMVQEAERYKAEDEEVKK
KVDAKNSLENYAYNMRNTVKDEQIAGKLDPADKQKIEKAIDEAIEWLDRNQLAEVEEFED
KQKELEGLCNPIIAKMYQGPGGNVPMGGGAQMPGSGFGNTTSGGGSGAGPTIEEVD
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaaagacgcaaggcaaggccatcggcatcgacctcggcaccacctacagctgc
gtcggggtgtggcagaacgaccgcgttgagatcatagccaatgaccagggaaacaggacc
accccttcctatgtcgccttcaccgacacggagcgtttgatcggcgatgcagcgaagaac
caagtcgctatgaacccccaaaacaccgttttcgacgccaagagactcatcggcaggcgg
ttctccgacccttctgtccagagcgacatgaagcactggcctttcaaggtcgttgctggt
cccggcgacaagcccatgattgtggtaaattacaaaggcgaagagaagcagtttgcggcg
gaagagatttcgtcaatggtgctgactaagatgagggagattgccgaggcttatttgggt
cacccttgcaacaacgctgtggtcactgtacctgcttacttcaatgactcgcagcggcag
gccacaaaggatgctggctccattgccgggctcaatgtgatgaggattatcaacgagcct
actgctgctgccattgcttacggtcttgacaagaagggatccagtactggcgagaagaat
gttcttattttcgatcttggtggcgggacttttgatgtttctttgctcacaattgaggag
gggatcttcgaagtgaaggctactgctggtgatactcatcttggtggtgaggattttgac
aacaggcttgttaatcactttgtgcaggagtttaagagaaagcacaagaaggatattagt
agcaacgccagagctttgaggagattgaggactgcgtgcgagagggcgaaaaggactttg
tcttccaccgcccagaccaccattgagatcgattcgctctacgaaggtattgatttctat
tctacaattactagggcgagatttgaagagatgaatatggatttgtttaggaagtgtatg
gaacctgttgaaaagtgtttgagggattccaaaatcgacaagagtcgagttgatgaggtt
gttttggttggtgggtcgacgagaattcccaaagttcagcagcttttgcaagatttcttc
aatggcaaggaattgtgcaagagcataaaccctgacgaagccgtggcttacggtgctgct
gttcaagctgcaattttaagcggcgaaggaaatgagaaggtccaagatctattgcttctt
gatgtcactcctctcagcctcggtcttgagactgcaggtggtgtcatgaccgtcttgatt
ccgagaaacacaaccattcctaccaagaaggagcagatcttctctacctactccgacaac
cagccaggagagttaattcaggtgtatgaaggagagagggctagaaccaaggacaacaac
ctccttggcaagtttgaactcacgggcattcccccggcgccaagaggcgtccctcagatc
aatgtctgctttgacattgatgcaaatggtatcttgaatgtatcggcggaagacaagact
gctggagtgaagaacaagatcactattaccaacgacaagggaagactgagcaaggaagag
attgagagaatggtgcaggaggcagagaggtacaaggctgaagatgaggaggttaagaag
aaggtggatgccaagaactcgctcgagaactacgcatacaacatgcggaacaccgtcaaa
gatgagcagattgctggaaaattagaccctgcagacaagcagaagattgagaaggccatt
gacgaggcaatcgagtggctagaccggaaccagttggcggaggtggaggaatttgaggac
aagcagaaggagttggagggattgtgcaacccgatcattgccaaaatgtatcagggtcct
ggaggaaatgtgccgatgggcggtggtgctcagatgcctggtagcggatttggaaacact
acgtccggtggcggatcaggagccgggcctacgattgaggaagttgactaa

DBGET integrated database retrieval system