KEGG   Pyrus x bretschneideri (Chinese white pear): 103945407Help
Entry
103945407         CDS       T03446                                 

Definition
(RefSeq) probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Pathway
pxb03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    103945407
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pxb03041]
    103945407
Enzymes [BR:pxb01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     103945407
Spliceosome [BR:pxb03041]
 Complex C
  Other components
   Step II factors
    103945407
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind S1 Helicase_C DEAD AAA_22 AAA_19 AAA_30 T2SSE ABC_tran DUF2075 Sigma54_activ_2 PhoH AAA_16
Motif
Other DBs
NCBI-GeneID: 103945407
NCBI-ProteinID: XP_009354244
Position
Unknown
AA seq 1221 aa AA seqDB search
MAATDDGLKKLEYLSLVSKVCSELETHLGFGDKVLAEFITEIGRSCETVDEFDARLKENG
AEMPDYFVRTLLTIIHAILPPKPKPEKDASKKDGASEGKKTKFKALAIADNRDRVKEIDK
EIEMETREKHTGGEERDGEREDDRRRGRDRYRDGDGDGDRDRDRDRDRDRDRDRHRGRXX
XXXXXXXXXXERDGRGRGRDRHDRDERRRHSHYNDDDGERGRHTDRYDKHKRDGYEENGI
EREDGDDRRGNRDRRNGPSKNLSDEPELYQVYKGRVSRVMDTGCFVQLNDLRGKEGLVHV
SQMATRRISNAKDVVKRDQEVYVKVISVSGQKLSLSMRDVDQHSGKDLLPLKKSSEEDAH
RTNMSVSRDGPVTRTGLSGIRIVEEDDVGPSRRPLKRMSSPEKWEAKQLIASGVLGVTEY
PMYDDEADGMLYQEEGAEEELEIEINEDEPAFLNGQTRYSVDMSPVKIFKNPEGSLSRAA
ALQSALIKERREVREQQQRTMLDSIPKDLNRPWEDPMPETGERHLAQELRGVGLSAYDMP
EWKKDAFGKTISFGQRSKLSIQEQRQSLPIYKLKKELVQAVTENQVLVVIGETGSGKTTQ
VTQYLAEAGYTTKGKIGCTQPRRVAAMSVAKRVAEEFGCRLGEEVGYAIRFEDCTGPDTV
IKYMTDGMLLREILIDENLSQYSVVMLDEAHERTIHTDVLFGLLKKLLIRRPDLRLIVTS
ATLDAEKFSGYFFDCNIFTIPGRTFPVEILYTKQPESDYLDASLITVLQIHLTEPEGDIL
LFLTGQEEIDFACQSLYERMKGLGKNVPELIILPVYSALPSEMQSRIFDPAPPGKRKVVV
ATNIAEASLTIDGIFYVIDPGFAKQNVYNPKQGLDSLVITPISQASAKQRAGRAGRTGPG
KCYRLYTESAYRNEMSPTSIPEIQRINLGMTTLTMKAMGINDLLSFDFMDPPSPQALISA
MEQLYSLGALDEEGLLTKLGRKMAEFPLDPPLSKMLLASVDLGCSDEILTIIAMIQTGNI
FYRPREKQAQADQKRAKFFQPEGDHLTLLAVYEAWKAKNFSGPWCFENFVQSRSLRRAQD
VRKQLLSIMDKYKLDVVSAGKNFTKIRKAITAGFFFHGARKDPQEGYRTLVENQPVYIHP
SSALFQRQPDWVIYHELVMTTKEYMREVTVVDPKWLVELAPRFFKVSDPTKMSKRKRQER
IEPLYDRYHEPNSWRLSKRRA
NT seq 3666 nt NT seq  +upstreamnt  +downstreamnt
atggcggccaccgacgacggtctgaagaagttggagtacctttcgctggtctccaaagtc
tgttcagagctcgaaacgcatctagggtttggggacaaagttctggcggagttcatcacc
gaaatcggacggagctgtgagacggtggacgaattcgacgcccgattgaaggagaacggc
gcagagatgcccgactacttcgtccgtacacttctcactatcatccacgcaatcctccct
ccgaagccgaagccggagaaggacgcctcgaagaaagacggcgcttctgaaggtaagaaa
accaagtttaaggctttggctattgctgataatagagatagagttaaggagattgataag
gaaattgagatggagactagggagaagcacaccggcggagaggagcgggatggagagcgt
gaagacgataggcggaggggtagggatagatatagggatggagatggagatggagataga
gatagagatagagatagagatcgagatcgagatcgtgataggcatagaggtagggnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnngaaagagatgggagaggcaggggaagggat
aggcatgatagagatgagaggcgtagacattcacattataatgatgatgatggggaaaga
gggaggcatacagatcgatacgataagcataagagagatgggtatgaagagaatggaatt
gaaagagaagatggtgatgataggagaggtaatagggataggcggaatggccctagtaag
aacctttccgatgaacccgaattgtaccaggtgtataagggtagggtttcgagagtgatg
gacaccggttgctttgttcagttaaatgatttgagagggaaggaaggtttggttcatgtt
tcacagatggcaactcggcgaattagtaatgctaaggatgtggtgaagagggatcaggaa
gtttatgttaaggtgatctctgtttcgggtcagaagttgagcctttcaatgagggatgtt
gatcagcattctgggaaggatttgcttccgttgaagaagagctcagaggaggatgctcat
aggaccaacatgtcggtgtccagagacggacctgtgactaggactggtctttctgggatt
aggattgtggaagaggatgatgttggtccatcgcgccggccattgaagcgaatgagctca
cctgagaagtgggaagccaaacagttaattgcctcaggtgttttgggtgtgacagagtac
ccaatgtatgatgatgaagcagatgggatgctatatcaagaagagggagctgaggaagag
cttgagattgagatcaatgaggatgagccggcctttttaaatgggcagaccaggtattct
gtggatatgtcccctgtaaaaatctttaagaatccagaagggtctttgagtcgtgcagct
gcacttcagtctgcactcattaaggagcgtagagaagtgcgagagcagcagcaaagaact
atgttggattccatcccaaaggatctgaatcgtccctgggaagatccaatgccagagact
ggtgagaggcatcttgcccaggagcttagaggtgttggtttgtctgcatatgatatgcct
gagtggaagaaggatgcttttgggaaaaccatcagctttgggcagaggtctaagctatca
attcaggaacagaggcagagcttgcctatatacaagctgaagaaagaattggttcaggcg
gtgactgagaatcaagtgctcgttgtcattggtgagactggttctggtaagacaacccag
gtgacacagtatcttgcagaagcgggttacacgacaaagggaaagattggatgtacacag
ccccgtagggttgctgcaatgtctgtagccaagagggtggctgaagagtttggttgtcgt
ttgggggaggaagttggatatgctattcgttttgaggattgcactggaccagatactgtc
atcaagtacatgacagatggtatgcttcttagggagattttgattgatgagaacctttcc
caatactctgtggtcatgcttgatgaagctcatgagaggacaatccacacagatgttctt
tttggactactgaagaagcttctgatccggagaccagaccttcgtttgattgtcacctct
gctactttggatgcagagaagttttcaggttatttctttgactgtaacatatttactatc
cccgggagaacttttcctgtcgagatactctacaccaagcagccagaaagtgactacctt
gatgcatctctaattactgtcctacaaatccacttaacagaacctgaaggtgacatcctt
cttttcttgactggacaagaagagattgattttgcatgccagtctctttatgagaggatg
aagggtcttggtaaaaatgttcctgagttaattattctaccagtatatagtgcccttcct
agtgaaatgcagtcaaggatatttgatcctgccccgccagggaagaggaaagtggttgtg
gctactaatattgctgaagcatcactgactattgatgggatattttatgtcatcgatcct
ggatttgcaaagcaaaatgtttataacccaaagcaggggttggattcgcttgtcattact
ccaatttcgcaagcatcagccaagcaacgagctgggcgtgctggacgcacagggcctggg
aaatgttaccgcctctacactgagagtgcataccgtaatgagatgtcccctacttcaatt
ccagaaatccagaggataaatcttgggatgactacacttacgatgaaagccatggggata
aatgatctcctgtcttttgattttatggatcctccttcaccgcaagcactcatttctgcc
atggaacaactgtacagtttgggagcactggacgaggaggggctgctgaccaaattgggt
aggaagatggctgagtttcctcttgatccaccgttatctaagatgctactcgctagtgta
gaccttggatgtagtgatgagatcttgaccatcattgcaatgattcagacaggcaatatc
ttttacaggcctagggaaaaacaagcccaggctgatcagaagagagctaagtttttccag
ccagagggagaccatctgactttacttgcagtctatgaggcttggaaagctaagaatttc
tcaggtccatggtgttttgagaactttgttcagtctcgatccttgaggagggcacaggat
gtcagaaaacagcttctgagcatcatggacaagtataaattggacgtggtcagtgcagga
aagaattttacaaagatcaggaaggcaattacagcaggtttcttcttccatggtgctaga
aaggacccgcaggagggttatagaacccttgtcgagaaccagccagtttatatccaccca
agcagtgctctcttccagagacaaccagattgggtcatctaccatgagctggttatgact
acaaaggagtacatgcgtgaggtgacggtcgttgaccccaaatggctagtagaactggca
ccaaggttcttcaaagtatcagatcccacaaagatgagtaagcgcaagcgtcaggaacga
attgaacccttatatgacagataccatgaacctaactcttggcgtcttagtaagcgtcgt
gcttga

DBGET integrated database retrieval system