KEGG   Pyrus x bretschneideri (Chinese white pear): 103946661Help
Entry
103946661         CDS       T03446                                 

Definition
(RefSeq) protein PHYLLO, chloroplastic isoform X1
  KO
K14759  isochorismate synthase / 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase / 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase / O-succinylbenzoate synthase [EC:5.4.4.2 2.2.1.9 4.2.99.20 4.2.1.113]
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Pathway
pxb00130  Ubiquinone and other terpenoid-quinone biosynthesis
pxb01100  Metabolic pathways
pxb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    103946661
Enzymes [BR:pxb01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.9  2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase
     103946661
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.113  o-succinylbenzoate synthase
     103946661
   4.2.99  Other carbon-oxygen lyases
    4.2.99.20  2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
     103946661
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.4  Transferring hydroxy groups
    5.4.4.2  isochorismate synthase
     103946661
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N MR_MLE_C Abhydrolase_6 TPP_enzyme_M_2 Abhydrolase_1 TPP_enzyme_C Hydrolase_4 Abhydrolase_2 Thioesterase Abhydrolase_3 BAAT_C Ndr DLH DUF676 DUF2974 Esterase
Motif
Other DBs
NCBI-GeneID: 103946661
NCBI-ProteinID: XP_009355695
Position
Unknown
AA seq 1714 aa AA seqDB search
MLLLTNPLSFRCCKRSLSLPRTMPPSLPPPFPFFNPKSRHFRLPPNPNSKAVGGVRFDGP
AIEVGQVSETEDGDLVIETGVTRTLPPALTLQQGLEKIREAVEELKRNPPSTCTGIHRFQ
VAVPPSAKALNWFCSQPETSAVYPLFFIGKDAKNPSYKSLYANETRGVFGIGAAVHFAPS
SSSSSVKRYLSNESTSVMAYGLVDINYDHESSFIKHEAGSYHFFVPQIELHEYEGASVLA
ATIAWSDSSLCTFVEAIHSFELCFNQASCHCWHTPKSSHSMNIRRTLGKLKLHEYGNVPL
VYMNALSSSRKYVVANITTLKETPFSCQFCIKLSPTIAVSSNMLDHTNKMCCSVEDWANI
NTVWASLIIEECSRLGLTYFCVAPGSRSSPLAVAASTHPLITCMVCYDERSLAFHAVGYA
RGSQKPAVVITSSGTAVSNLLPAVVEASQDFVPLLLLTADRPAELHDAGANQAINQVNHF
GSFVRFFFSLPAATDRISARMVLTTLDSAVHWATSSPCGPVHINCPFREPRENSPSKWMT
SCLKGLDFWMSSTEPFTKYIKVQSAHTYDDGCGQMSEILNLIRGTDKGILLIGAIHSEDE
MWAVLLLVKHLQWPVVADILSGLRLRKLLTSFPEIGDDLLFVDHLDHALLSDSVRSWINF
DLIIQIGSRITSKRVAKMLEDCFPCSYILVDKHPFRHDPSHIVTHRIQSSIVEFSDCLCK
AGLPCMSKERSTYLQTLNVMVSRELSFQIYARDFLTEPQVASVISKALSAESALFIGNSM
AIRDADMYGCGWSGCSHNTASMISKLQLPCHMIRVAGNRGASGIDGLLSTAVGFAVGCNK
RVLCVIGDVSFLHDTNGLAIVNQRTLRKPMTIVVINNHGGAIFSLLPIADTVEPSILNQY
FYTSHNVSIHNLCVAHGVMHLHVKTKVELEDALLTSQDKEVDCVIEVEGCIDANATFHSI
LRKFACQAADHALSLSSKISVQDSPADGTLLYRVHRMEYSVFSIPLCAPPTMVSVDDNET
SFYREGFILTLYLEDGSIGFGEVSPLDIHRESLLDVEEQLRLLVLMMEGAKISCFLPLLK
GSFSSWIWTNLGILPCTLLPSVRCGLEMAILNALATRQGSNLLGLLHPLKAEGGISERPM
TVQICALVDSNRTPTQVADVVAALVEEGFTAVKLKVARQGSPLHDAAVIQAVRKKVGYQI
QIRADANRNWTYKEAIQFGSLVKDCDLQYIEEPVQNEGDIVKFCEESGLPVALDETIDSI
REHPLDKLVKYTHPGIVAIVIKPSVVGGFENAAIIAQWAQQHQKMAVVSAAFESGLGLSA
YIQFCCYLNLKNSEICEMMNYELAPSIAHGLGTYRWLKEDVTTTPLKIGCNPVSGFVEAS
VADADQVIQKFQINGNVVHRNFTGEQVRVFQLTVDSKAFSYSIIVHEIGERYNENVFVFL
HGFLGTGEDWIAMMKAISGCARCISIDLPGHGGTKIQNHGDNDAVQDSGLSIEVVADLLC
EVIKQITPGKVTIVGYSMGARIALYMALRCTDKVNGAVVISGSPGLKDEVDRKIRRAKDD
SRARFLIDHGLELFLDTWYSGELWNSLRVHPRFRQIVSSRLHHEDVQSLAKVLSGLSIGR
QPPLWEDLKHCKTPLLLIVGEEDKKFKAIAKDMSCEFAGGTASGDGPPHDIYEIVEIPDC
GHAAHLENPLPVISTLRRFLGRVNSNLIQNQKAI
NT seq 5145 nt NT seq  +upstreamnt  +downstreamnt
atgctattactcacaaatcctctctctttccgatgttgcaagaggtctctgtctctcccg
cgcacaatgccgccctcactgccaccgcctttcccgttcttcaacccaaaatcccgccat
tttcgtctgcctccaaaccctaactccaaggccgttggaggagtaagattcgacggcccg
gcgatcgaagttggccaagtgtcggaaaccgaggacggcgacttggtgatcgagaccggc
gtcacgcggacgctgcctccggctttgactcttcagcaaggacttgaaaaaatcagagag
gccgttgaggagttgaagcgcaatcctccttccacttgtaccggaattcataggtttcag
gtggccgtgcccccgagtgccaaagccttgaactggttttgcagtcaaccggagacttct
gcggtttatcctctgtttttcattggcaaggatgccaaaaacccgagttataagtcgctg
tatgcaaatgaaactcgaggagttttcggaattggtgccgcagttcactttgcaccttca
tcatcttcttcttcggtcaaaagatatctttcaaatgaatcaacctctgtaatggcttat
ggtttggtggatattaattatgaccacgagtcatctttcataaaacatgaagcaggttct
taccactttttcgttcctcagattgagttacatgagtacgagggcgcttctgttttagca
gcaacaattgcttggagtgactcttccctttgtacatttgtggaagccattcattctttt
gagttatgtttcaaccaggctagttgtcactgttggcacacgccaaagagctcccactcc
atgaatataagacgtactcttggaaagctcaagcttcatgagtatggaaatgttcctttg
gtatacatgaacgctctgtcatcaagcagaaaatatgttgtggctaacatcacgacgctg
aaagagactccgttttcctgccagttttgtatcaagctttcacctaccattgcagtttct
agcaacatgttggaccataccaataaaatgtgctgctcagttgaagattgggccaacatc
aataccgtttgggcatcacttataattgaagaatgttctcgacttggtttgacgtatttt
tgtgtagctccaggatcaagatcatcccctcttgctgttgctgcctccactcatcctctt
attacatgtatggtatgttatgacgagcgctcacttgcatttcatgctgttggttatgca
agaggatctcagaagccagctgttgtcataacgtcatctggaactgcagtttcaaatctt
cttcctgctgttgtcgaggctagtcaagattttgtaccactcctattgctcacagctgac
cgtcctgcagaattgcatgatgctggagcaaaccaagctatcaatcaggtaaaccatttt
ggttcttttgtgaggtttttcttcagccttccagcagccaccgatcgtatttcagcaagg
atggtacttacaacacttgactctgctgtacattgggcaacctcgtcaccgtgtggccct
gttcatattaactgtcctttcagggagccacgggaaaatagccctagcaaatggatgacg
agttgtttgaaaggattagacttttggatgtctagcaccgagccatttactaagtatatt
aaagtacagagtgctcacacgtatgatgatggttgtgggcaaatgtcagagattctaaat
ctaattagagggactgataaagggattctactaattggtgcaatccattcagaagatgag
atgtgggcagttcttctcttggttaaacaccttcaatggcctgttgtagctgacatcctg
tcaggattacgattgagaaagctgctgacttcttttcctgaaattggagatgatttgtta
ttcgttgatcatcttgaccatgctctactttcagattccgtgcgtagttggataaatttt
gatctgattattcagattgggagtagaattacaagcaagcgtgttgctaaaatgctagag
gactgctttccctgctcatatatcttggttgacaagcatccatttcgtcatgatccctct
catattgtaacccatagaatccaaagtagcattgttgaattttccgattgtttatgtaaa
gctgggcttccctgtatgagcaaagaacggagcacttaccttcaaacgttaaatgtgatg
gtttcgagggagttgtcatttcaaatttatgccagagacttcttgactgaacctcaagtt
gcaagcgtgatatccaaagcactttcagctgagtctgctcttttcattgggaacagtatg
gcgatacgtgatgcagatatgtacggatgtggttggtcaggttgtagtcataatactgca
tccatgatttcaaaattacaactaccctgtcatatgattcgggtggctgggaataggggt
gccagtggtattgatgggttactcagcacagctgttggctttgctgttggatgcaataaa
cgagtgctttgcgtgattggggatgtttctttcctccacgatacaaatggcttggcaatt
gtgaaccagaggacattgcggaaaccaatgacgatagttgtgatcaataatcatggtggt
gcaatattcagtctccttcctatagcggatacagttgagccaagcatactaaatcaatac
ttctacacctctcacaatgtttcaatccacaacctgtgtgtggcacatggtgtgatgcat
ctacatgtgaagacaaaggtggagctggaagatgcattattgacatctcaagataaagag
gtggattgtgtcattgaagttgagggctgcatagatgccaatgccacctttcacagtatt
ttaagaaagtttgcgtgccaagcagcagatcatgcgttgagcctctcctcaaagatttct
gttcaagactcaccagcagatggcactttactttatagagtccatagaatggagtattca
gtatttagtataccactctgtgctcctcctactatggtttctgttgatgataatgaaacc
agcttctacagagaagggtttattttaactttgtatcttgaggatggaagcattgggttt
ggcgaggtttcgcctctcgatatccacagagaaagcctgcttgatgtagaagagcaactg
aggttacttgttcttatgatggaaggagctaagattagttgcttccttcctctgctaaag
ggctctttttcttcttggatatggaccaacctgggaatactgccatgcacgctcttgcct
agtgttagatgtggtttggaaatggcaattctcaatgcattagcgacaaggcaaggttcc
aacttattaggcctactccatcccttgaaagctgaaggaggtatatctgaaaggccgatg
acagttcagatttgtgccctagttgattccaatagaacgcccactcaagtagctgatgtt
gtagcagcacttgttgaagaaggatttactgcagtaaagctgaaggtagcacgtcagggg
agtcccttgcacgatgctgcagttatacaggcagtaagaaagaaagttgggtaccagatt
caaattcgtgcagatgccaatcggaactggacatataaagaagctatccaatttggttcc
ttggtaaaggattgtgatctgcagtatattgaggaacctgttcaaaacgaaggtgatatt
gtcaagttctgtgaagaaagcgggttacccgtggcactggatgaaactattgacagtatt
agagaacatccacttgacaagctagtgaagtacacccatccaggaatagtagctattgtt
attaaacctagtgttgttggtggctttgaaaatgcagcaataattgctcagtgggctcag
cagcaccagaaaatggccgttgttagtgctgcatttgaaagtggcctaggtttgtcagca
tatattcagttttgctgttatctcaacctgaaaaattcagaaatctgtgaaatgatgaat
tatgaattggccccgtcaatagcccatggtttaggaacataccgctggctaaaagaagat
gtaacaaccactcctctcaagataggttgtaatccagtcagtggcttcgtagaagcatct
gttgctgatgctgatcaagttattcaaaaatttcaaataaatggcaatgtagttcataga
aattttactggagagcaagtccgcgtattccagcttactgtagattcaaaggctttctct
tattccatcatagtccacgagattggagaaagatacaatgaaaatgtttttgtatttctt
catgggtttcttggaactggtgaagattggattgctatgatgaaggcgatttcaggatgt
gcaagatgcatttcgattgaccttcctggtcatggtggaacaaagatacagaaccatggt
gataacgatgctgtacaggattcaggtttgtcaattgaggttgttgccgatcttttatgt
gaagtgattaaacagattacgcctggaaaggttactattgtgggttactctatgggagca
aggattgcactctacatggctttgaggtgtacagacaaagtcaatggagctgttgtaata
tctggaagccctgggttaaaagatgaagtggatagaaaaattcgtagagctaaggatgac
tctagagctcgcttccttattgatcacggcttagagctcttcctagacacctggtattct
ggagagctgtggaacagcttaagagtccatccccgatttcgtcagatagtttccagccgc
ctgcatcatgaagatgtgcagagtcttgcaaaagtgctttccggtttaagtattgggagg
cagccgccattgtgggaagacttgaagcactgcaaaacaccccttttgctaattgttgga
gaggaggataaaaagttcaaggcgatagctaaggatatgtcctgtgaatttgctggtggc
acggcgagtggagacggccctccccatgacatctatgagatagttgagattccagattgc
ggacatgctgctcatctggagaaccctctccctgtaatcagcacattgagacgatttttg
gggagagtgaactcgaatttgattcaaaaccagaaggcaatttag

DBGET integrated database retrieval system