KEGG   Pyrus x bretschneideri (Chinese white pear): 103946793Help
Entry
103946793         CDS       T03446                                 

Definition
(RefSeq) aldehyde dehydrogenase family 3 member H1-like
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Pathway
pxb00010  Glycolysis / Gluconeogenesis
pxb00053  Ascorbate and aldarate metabolism
pxb00071  Fatty acid degradation
pxb00280  Valine, leucine and isoleucine degradation
pxb00310  Lysine degradation
pxb00330  Arginine and proline metabolism
pxb00340  Histidine metabolism
pxb00380  Tryptophan metabolism
pxb00410  beta-Alanine metabolism
pxb00561  Glycerolipid metabolism
pxb00620  Pyruvate metabolism
pxb01100  Metabolic pathways
pxb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103946793
   00053 Ascorbate and aldarate metabolism
    103946793
   00620 Pyruvate metabolism
    103946793
  09103 Lipid metabolism
   00071 Fatty acid degradation
    103946793
   00561 Glycerolipid metabolism
    103946793
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    103946793
   00310 Lysine degradation
    103946793
   00330 Arginine and proline metabolism
    103946793
   00340 Histidine metabolism
    103946793
   00380 Tryptophan metabolism
    103946793
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    103946793
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    103946793
Enzymes [BR:pxb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     103946793
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh Proteasom_PSMB YkuI_C TMEM108 DUF1090
Motif
Other DBs
NCBI-GeneID: 103946793
NCBI-ProteinID: XP_009355863
Position
Unknown
AA seq 560 aa AA seqDB search
MKGLCIDLFKNYSLGLAGTAGIGAGTRSSRAFTHPSQRRRSNYQNQKHFSSSKLTCSSYS
TKPCSATLSAVTAEVEEAKQTFNPEKAGLLAKELRKSFNSGRTKSYEWRRSQLENIAKML
EEKEKEIAEALYKDLSKPEIEAFISEIVQAKSSCNEALKELKHWMVPQKVSTPITTYPSS
AEIVSEPLGVVLVISTWNFPFLLSLDPVIGAISAGNAVVLKPSEIAPATSSLLANLVEEY
LDNSAVKVVEGAVPETTALLEQKWDKILYTGSARVGRIVMAAAAKHLTPVILELGGKSPA
VVDSDVNLEVAVRRIMAGKWALNNGQACIGVDYIITTKDFAPKLIEALKYGLEQFFGKDP
MNSKDISRIVSSTQFTRLAKLLDEDKVSNKIVLGGQRDEKQLKIAPTILLDVPEDAQIMQ
EEIFGPLMPIVTVEKIEDSFSVINSKPKPLAVYAFTNNEQLKKGFVDNVSSGGMLINDTV
LHVSISGLPFGGVGESGMGSYHGKFSFDGFSHKKAVLYRGFGGDSDLRYPPYTPEKQRLF
KAVINRDILTIILSLIGWSK
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggcctctgcattgatctttttaagaattacagtttgggtttagcgggtactgct
gggataggggctggtactcggagcagcagagctttcactcacccgtctcagagaagaaga
agcaactatcaaaaccagaagcatttctcttcctccaaacttacatgctcttcctactcc
actaaaccttgttctgcaactctgtcggctgtaaccgcggaggttgaagaagcaaagcaa
acattcaatccggaaaaagctggtcttctagctaaggagctgcgaaagagttttaattcg
ggaaggacgaaaagctatgagtggagaaggtcgcagttggagaatattgcaaagatgctt
gaagaaaaagagaaggagatcgctgaagctctttacaaggacctttcaaagcctgaaatc
gaagcatttatatccgagattgttcaggcaaaatcgtcatgtaacgaggcattgaaagaa
ttgaagcattggatggttccacagaaggtcagcactccaatcacaacatatccatcatca
gcagaaattgtgtcagaacctctaggagttgtgttggtcatctcaacatggaacttccct
ttcttgttatctcttgatccagtcattggagctatttcagccggcaatgcggttgtgcta
aaaccctcagaaattgctccagctacatcttcactacttgcaaatttagtagaggagtac
ttagataactcagctgtaaaagttgttgagggcgctgttccagaaacaactgcattgtta
gagcagaagtgggataagatactctatacaggtagtgcaagagtagggcgcattgtgatg
gctgctgctgcaaaacaccttacacctgtaattctggaactcggtggaaagtccccagct
gttgtcgactcagatgttaacttggaggtggctgttaggaggataatggcaggcaaatgg
gcattgaacaatggacaagcttgcatcggtgttgattacattatcactacgaaagacttt
gctccgaagttgatagaagctctaaagtatggtctcgagcagttctttgggaaagatccg
atgaactcaaaggatatatcacggatagtgagctctacccagtttacacggttggcgaag
ctgctggatgaagataaggtctctaataagattgtcctcggtggccaaagggatgagaag
caattaaaaatagctccaactatcttgttggatgttccagaagacgctcaaattatgcag
gaggagatatttgggccattaatgccgatcgtcactgttgagaagattgaagacagtttc
agtgtgataaattcaaagccaaagcctcttgcagtatatgcctttacaaacaatgagcag
ctgaagaagggcttcgtggataacgtatcatctggaggaatgctcatcaatgacaccgtc
cttcatgttagcataagcggtttaccatttggaggagttggggagagtggaatgggttca
taccacggaaaattctcctttgatggttttagccacaagaaagcagttctttatcgaggt
ttcggtggagattccgatttgaggtatccaccctacacaccggaaaagcaaagattattc
aaggccgtgattaatcgcgacatattaaccataatcttatctctgattggatggtctaaa
tga

DBGET integrated database retrieval system