KEGG   Pyrus x bretschneideri (Chinese white pear): 103947112Help
Entry
103947112         CDS       T03446                                 

Definition
(RefSeq) cysteine--tRNA ligase 2, cytoplasmic-like
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Pathway
pxb00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    103947112
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pxb01007]
    103947112
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pxb03016]
    103947112
Enzymes [BR:pxb01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     103947112
Amino acid related enzymes [BR:pxb01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   103947112
Transfer RNA biogenesis [BR:pxb03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    103947112
 Prokaryotic Type
    103947112
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1e tRNA-synt_1g tRNA-synt_1 DALR_2 tRNA-synt_1f DUF2067
Motif
Other DBs
NCBI-GeneID: 103947112
NCBI-ProteinID: XP_009356244
Position
Unknown
AA seq 560 aa AA seqDB search
MAAGKDFMVYNSMTRQKEIFRPIEPGKVSMYVCGITAYDLSHLGHARAAVNFDVLFRYLK
HLGYEVTYVRNFTDVDDKIIMRSNENGEDPFSLSSRFCKEYLKDMGDLQCLLPTHQPYVS
EHIEHIKDLITQIINKEYAYLVGGDVFFAVDKFPNYGQLSGQKLEHNRAGERVAVDSRKR
NPADFALWKSAKPGEPSWESPWGPGRPGWHIECSAMSAHYLTFKFDIHGGGIDLIFPHHE
NEVAQSCAACQESSVSYWMHNGHVTNNNEKMSKSLNNFFTIREITEKYHPLALRHFLISA
HYRSPLNYTISQLESSSDAIYYVYQTLQDCEDALAPLREEGLKEGADQNGKIVKITLTAQ
ECISKLKNEFGSKMCDDLNTAQILTGAFQDALKFINSSLNGLKKKQQKQKQLSMVQSLID
VKKAVTDDVLDVLGLKSPHTYSEVLQQLKVKALERAGMVENDVLKKIKERKRARENKDFA
MSDQIRADLTRKGIALMDVGKETIWRPCVREEPIKEEEKQLPTEEKQKVLPVEQKEEQKQ
LSSEEEHKALPVEGELPAST
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atggcggccggcaaggactttatggtttacaactcgatgacccgccagaaggagatcttc
aggccgatagaacccggcaaggtcagcatgtacgtctgtggaattaccgcctatgatctc
agccatctcggccacgctcgcgccgccgtcaatttcgatgtcctcttcaggtacttaaag
catttgggttacgaggttacgtatgtccggaatttcactgatgttgatgacaagataata
atgcgatcaaatgagaatggtgaagacccatttagtttaagcagtcgtttttgcaaagaa
tatctcaaggacatgggtgatctccagtgccttcttcccacccatcagccatatgtttct
gagcacatagaacatatcaaggatttgataacacagattattaacaaagaatatgcatat
ctggttggcggggatgtattctttgctgttgataaatttccaaattatggccagttatct
ggacaaaaattggaacacaatcgggctggtgaacgagttgctgttgattcaaggaagcgt
aatcctgcagactttgcattgtggaagtctgcaaagcctggtgagccaagttgggaaagc
ccttggggacctggtagacctggatggcacattgaatgcagtgcaatgagtgcacattat
ctgacattcaagtttgatattcatggcggcggcattgacttgatttttccacatcatgag
aatgaggttgcccagagctgtgctgcatgccaagagagcagtgtgagttactggatgcat
aatggacatgttaccaataacaacgagaaaatgtcaaaatccctcaacaactttttcact
attagggagattactgaaaagtaccatccactggctttgagacacttcttgataagcgct
cactataggtctcccctcaactacacaatctcccagctggaaagttcatcagatgctatt
tattacgtatatcagaccttgcaagattgtgaagatgctttagctccacttcgagaagag
ggtctgaaggaaggtgcagatcaaaatggcaaaatagttaaaattactctgactgcccaa
gaatgcatcagtaagctaaagaatgagtttgggtccaaaatgtgcgatgacttaaacact
gcccagatattgactggtgctttccaagatgcgttgaagtttataaacagttctttgaat
ggacttaagaagaagcagcaaaagcaaaaacagttatcaatggtccaatcactaatcgat
gtaaagaaagcagtaactgatgatgttctggacgttttgggtttaaaatcgccccataca
tactcggaggttttgcagcaattgaaagtgaaagcattggagagagcagggatggtggaa
aacgatgtactgaagaagattaaagagagaaaacgagcaagggaaaacaaagattttgca
atgagtgatcagatcagagctgatttgactagaaaaggcattgcactcatggacgtgggc
aaggagacaatctggagaccttgtgtacgagaggagcccatcaaggaagaggaaaaacag
ctgccgactgaagagaaacaaaaggtattgccggttgaacaaaaggaagagcaaaagcag
ctgtcaagtgaagaagaacacaaggcattaccggtcgaaggggaactgcctgcgtcgaca
tga

DBGET integrated database retrieval system