KEGG   Pyrus x bretschneideri (Chinese white pear): 103950106Help
Entry
103950106         CDS       T03446                                 

Definition
(RefSeq) beta-glucosidase 13-like
  KO
K01188  beta-glucosidase [EC:3.2.1.21]
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Pathway
pxb00460  Cyanoamino acid metabolism
pxb00500  Starch and sucrose metabolism
pxb00940  Phenylpropanoid biosynthesis
pxb01100  Metabolic pathways
pxb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    103950106
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    103950106
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    103950106
Enzymes [BR:pxb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     103950106
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-GeneID: 103950106
NCBI-ProteinID: XP_009359532
Position
Unknown
AA seq 583 aa AA seqDB search
MEDAIDAGREKGDSDGERGSVVVTAGDIVTANTRNKVESTSDLHLNQKKMEASPCSVISS
VAICVMVLVAAAASSALAQVEVNHSSIALTFELNITRDDFPSDFYIGVGTAATQTEGAAE
EEGRGPSVWDHRAKMLPGSIPNSDKFPFAIDGYKRCKEDIKIIKDLGVNAYRFSISWSRI
LPQGSLSGGINQRGVDHYNSLINELKRNGIEPFVTIYHFDMPQALQVKYGGYLNRKFVQD
FQDYSELCFKLFGDRVKHWFTINEPSSLAVYGYEIGIAPPGRCSLPEGQCGLGAPPPGTC
IVPAGPCFGGNSSTEPYIAAHNLILAHAAVAKLYREKYQEEQKGEVGIVLAATYFAPFSK
SQEDKAAAQRLFDFTLGWFMEPLVFGNYPRSMRDLVKERLPTFSAEEKSLLNGSLGNFVG
INYYSSAGAKHRPPPPAEQLRYSFDSWAEATATPNVSGVSHSNWPQGLQKLMNYVKNNYQ
RPQVYISENGYTNTRNDSRSLHDRLCDPHRASYIARHLYRLNKAMKNGANVKGYFYWALF
DDVEWGLGFSLQYGLYYIDFGNNYKRYPKLSARWFRDFNKKNY
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atggaggacgcaattgatgctggcagagaaaagggagattccgatggagaaaggggtagt
gtggttgtaactgctggtgatattgttacagcaaacaccagaaacaaagtcgagagcaca
agtgacttgcatttgaaccagaagaaaatggaagcatcaccttgttcagtcatttcttcc
gtggccatctgtgtcatggttttggtagctgctgctgcatcatctgccttggctcaagtt
gaggtgaatcacagcagtattgcactcactttcgaactaaacatcacccgagatgatttt
ccaagtgatttttacattggtgtcggcactgcagctacacagacggaaggggcagccgaa
gaagaagggagaggaccgagtgtgtgggatcaccgtgccaaaatgctcccaggtagcatt
ccgaacagtgacaaattcccttttgcaattgatggatacaaaagatgcaaggaggatatt
aagatcatcaaggatctcggagtaaatgcctacagattctccatctcgtggagtaggatt
ttaccacaggggagcttaagcggcggtattaatcaacggggtgtggatcactataacagt
ctaatcaatgaattaaaaagaaatggcatcgagccttttgtcacgatctatcacttcgac
atgccacaagcgctgcaagtaaaatatgggggctatttgaatcgcaagttcgtgcaagac
ttccaagactacagtgagctttgcttcaagttatttggagacagagtcaaacactggttc
accattaatgagccgagttctcttgcagtgtatggctatgagatagggattgccccacca
ggaaggtgttcccttccagaaggacaatgtgggttgggagctccacctccaggaacatgt
attgtgcctgccggtccctgctttggtggtaactcgtcaacggaaccttacattgccgcc
cataaccttatccttgctcacgccgcagtggcaaaactatatagggagaaataccaggaa
gagcaaaaaggagaagttggtatcgtccttgctgcaacctattttgcgccattttccaaa
tcacaggaagataaagctgcagcacagcgactctttgatttcaccctaggatggtttatg
gaacccttggtgtttggaaactatccacgaagcatgagagatctggtgaaggaaaggttg
cccaccttttccgcagaagagaaatccctactcaacgggagtttaggtaattttgttggg
ataaactattactcatcagctggtgcaaaacacaggcctcctcctccagcagagcagttg
cggtattcattcgattcatgggccgaagcaacagcgaccccaaacgtttccggtgtgtcc
catagtaattggcctcaagggctgcagaagctgatgaattatgtgaagaataattatcaa
aggccacaggtctacatttctgaaaatggatatactaatacaaggaatgacagccgttca
cttcatgaccgattatgcgacccccatcgagcttcctacattgctcggcatttgtatcgg
ctgaacaaggcaatgaagaatggagcgaacgtcaaagggtacttttactgggctctattc
gacgatgttgaatggggtcttgggttttcgctgcaatatggactttactatattgatttc
ggcaacaactacaagcgctaccccaagctctcagctaggtggttccgtgatttcaacaag
aagaactactag

DBGET integrated database retrieval system