KEGG   Pyrus x bretschneideri (Chinese white pear): 103951674Help
Entry
103951674         CDS       T03446                                 

Definition
(RefSeq) probable glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Pathway
pxb00480  Glutathione metabolism
pxb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    103951674
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pxb02000]
    103951674
Enzymes [BR:pxb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     103951674
Transporters [BR:pxb02000]
 Other transporters
  Pores ion channels [TC:1]
   103951674
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3
Motif
Other DBs
NCBI-GeneID: 103951674
NCBI-ProteinID: XP_018504039
Position
Unknown
AA seq 184 aa AA seqDB search
MAKVKLFMIWSSPFSLRIVWALQLKGVLYETIHEDLSNKSPLLLQSNPTHKKVPVLLHNG
NAVVESLIVLEYVNETWKENPLLPEDPLEQAIARFWARYGDEKVLPSIGESFMKEGKEQD
EAIVKAKENLKYLEEELNGKKLFGGEKLGFADIALGWLAHYVSVFEDVAEMKMVTEEEFP
LLSA
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagtgaagctctttatgatatggtccagccctttttctctaagaatagtttgg
gcactacaactcaaaggcgtcctatatgaaacaatccacgaagatctttcaaacaaaagc
cctttacttcttcagtctaaccctactcataagaaagttccagtgctcctgcacaatgga
aatgcagttgttgaatcactcatagttcttgaatatgtcaacgaaacttggaaggagaat
cccttactgccggaagatcctcttgagcaagcgattgcacgcttttgggccagatatggt
gatgagaaggttttgccatctattggggaatcctttatgaaggaagggaaagagcaagat
gaagctattgtaaaagccaaggaaaacttgaagtacctggaagaagagctaaacggaaag
aaattgtttggcggagagaaacttggatttgcggatattgcacttggatggctcgcacac
tatgtgagtgtgtttgaagacgtagcagaaatgaaaatggtgaccgaagaagagtttcca
ttgttatcagcatga

DBGET integrated database retrieval system