KEGG   Pyrus x bretschneideri (Chinese white pear): 103953513Help
Entry
103953513         CDS       T03446                                 

Definition
(RefSeq) probable carotenoid cleavage dioxygenase 4, chloroplastic
  KO
K09840  9-cis-epoxycarotenoid dioxygenase [EC:1.13.11.51]
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Pathway
pxb00906  Carotenoid biosynthesis
pxb01100  Metabolic pathways
pxb01110  Biosynthesis of secondary metabolites
Module
pxb_M00372  Abscisic acid biosynthesis, beta-carotene => abscisic acid
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    103953513
Enzymes [BR:pxb01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.51  9-cis-epoxycarotenoid dioxygenase
     103953513
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPE65
Motif
Other DBs
NCBI-GeneID: 103953513
NCBI-ProteinID: XP_009363530
Position
Unknown
AA seq 601 aa AA seqDB search
MDAFSSSFLSAFPAFSSSFLSAFPAFSSPKLSSISSIRMEERPSSQPPASRPPPSQQPPR
TTPPPPLAAKSDHAFQNNASTFTAAKQTVSALPAVIFNALDDFINSFIDPPVKPSVDPRH
VLSHNFAPVEELPPTECEIIHGSLPSCLDGAYIRNGPNPQYLPRGPYHLFDGDGMLHSVR
ISGGRAVLCSRYVKTYKYTVERDAGHPVLPNVFSGFNGLTASATRGALSAARVFTGQYNP
ANGIGLANTSLAFFGDRLYALGESDLPYSIRLTSNGDIETLGRHDFDGKLSMNMTAHPKI
DPDTGEAFAFRYGFIRPFLTYFHFDSNGVKQPDVPIFSMVTPTFLHDFAITKKHAIFADI
QIGLNLIDMITKRASPVGLDPSKVPRIGVIPRYAKDESEMRWFEVPGFNSVHATNAWDED
DAIVMVAPNVLSAEHTMERMDLVHSLVEKVRIDLKTGIVTRQPISTRNLDFAVINPAYLG
RKNKYVYAAVGDPMPKISGVVKLDVSNAEHKECVVASRMFGPGCYGGEPYFVAREPENPE
ADEDDGFLVSYVHDEKAGESRFLVMDAKSPLLDIVAAVRMPRRVPYGFHGLFVRESDLNK
L
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atggatgccttctcttcctccttcctatctgcatttcctgccttctcttcctccttccta
tctgcatttcctgccttctcttcccccaagctcagcagtatttcctctatcagaatggaa
gaaagacccagctcccaaccaccagcttcaaggccgccgccgtcgcagcagcctccgaga
accactccaccaccgccgctagcggcaaaatccgatcatgcttttcaaaacaatgcctca
actttcactgcggcaaaacaaacagtttctgcgctacccgcagtgatcttcaatgctttg
gacgatttcatcaacagcttcatcgaccctccagtgaaaccctcagtggaccccaggcac
gtgctctcccacaactttgctccggttgaggagcttccgccgacggagtgcgagatcatc
cacggctccctgccgtcatgcctcgacggagcctacattcgcaatggccccaacccgcaa
taccttcctcgtgggccctaccacctgttcgacggggacggcatgctgcactccgttagg
atctctggaggccgggcggtgctctgcagccgatacgtcaagacctacaagtacaccgtt
gagcgtgacgccggccaccctgtacttcccaacgtcttttctggcttcaacggcctcacc
gcttccgccacacgtggcgctctctccgctgcccgggtctttacaggccaatacaatcct
gcaaatggcattggtcttgcaaacacaagtttggccttctttggcgaccgactttacgct
ctcggcgagtccgatctcccttactccatccgcctgacgtccaacggagatatcgaaact
ctgggacgccatgatttcgatggcaagctctccatgaacatgacagctcatcccaagata
gaccctgacacgggggaggccttcgccttccgctatggctttatacggccgtttctaacc
tacttccacttcgattcgaatggcgtgaagcagccggacgttccgatattctccatggtc
actccaacgttcctccatgactttgcaatcaccaaaaaacatgccatatttgctgacata
caaattgggttgaaccttattgacatgatcactaaacgagcctcccccgttggtttggac
ccctcgaaagtgccgagaattggagtgattccgcggtacgcaaaggacgagtcggagatg
aggtggtttgaggtgccgggtttcaacagcgtacacgccaccaatgcatgggatgaggac
gatgctattgtgatggtggcaccaaacgttttgtcagcagagcacacaatggagaggatg
gatcttgttcattccttggttgagaaggttcggattgatctcaaaacggggattgtgacg
aggcagccgatttcgaccagaaatctggatttcgccgtgatcaatccggcttacctgggg
aggaagaataagtatgtgtatgcagctgtgggtgatcccatgcctaagatatcaggagtt
gtaaaattggatgtgtccaatgcggagcacaaggagtgtgttgtggccagcaggatgttt
gggcccgggtgctatgggggcgagccgtatttcgtggccagagagcccgagaatcctgag
gcggacgaggacgacgggtttttggtgtcgtatgttcacgatgagaaggccggggaatcg
aggttcttggtgatggatgcaaagtctcctctgcttgacattgtggctgctgtgaggatg
ccccggcgggtgccttatggcttccacggactctttgtgagggaaagtgatctcaacaag
ttgtag

DBGET integrated database retrieval system