KEGG   Pyrus x bretschneideri (Chinese white pear): 103953856Help
Entry
103953856         CDS       T03446                                 

Definition
(RefSeq) protein S-acyltransferase 24-like
  KO
K20032  palmitoyltransferase ZDHHC13/17 [EC:2.3.1.225]
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pxb04131]
    103953856
Enzymes [BR:pxb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     103953856
Membrane trafficking [BR:pxb04131]
 SNARE
  SNARE associated proteins
   Palmitoyltransferases
    103953856
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 DHHC Ank_5 Ank_4 Ank_3 Ank
Motif
Other DBs
NCBI-GeneID: 103953856
NCBI-ProteinID: XP_009363933
Position
Unknown
AA seq 636 aa AA seqDB search
MSSEIEVVEDEVQTGDPGSVSANSTNNNGDANRIGEESLRNDVYTAAAYGDLEKLQRLVE
CEGCSVSETDGLGYYALQWAALNNRTAAAQYIIEHGGDVNAADHTGQTALHWSAVRGAIQ
VAELLLQEGARVNAVDMYGYQTTHVAAQYGQTAFLYHIVSKRNADPDVPDNDGRSPLHWA
AYKGFADCIRLLLFLDAYKGRQDKEGCTPLHWAAIRGNLEACTVLVQAGKKDDLMVTDNT
GLTPAQLAADKNHRQVAFFLGNARRLLDKRCDGNSRLGGVSKLGLAPLLWCIIFVLLVTY
THSVIMAPSLPKLTAGSVFVAWLGVFLATSGLVMFYRCSSKDPGYIRMNVHDSQNMKDDE
PLLKIEINNPALLAGNWSQLCATCKIVRPLRAKHCPTCDRCVEQFDHHCPWVSNCIGKKN
KWDFFAFLVLEVLAMLFTGGVTLMRVSSDPLCPSSFGAWINFVATRHVGALSFFIMDFFL
FFGVAVLTVVQASQISRNITTNEMANMMRYNYLRGPGGGFRNPFDHGIRKNCSDFLVKGY
NEDVEHIEEPAHDEEGIGMRDINSSNLQKGDAYSHRRNGNSHVAIDVNSNSTPHHGHVHS
AHCSHSNNHGKSKTENVPVGLGLGLGRNSARSVVAS
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcggagatcgaggtcgtcgaggatgaggtccaaaccggtgatcctggatccgtc
tcagccaattcaacgaacaacaatggcgacgccaatcggattggggaagagagtctgcga
aacgacgtgtatacggcggctgcgtatggagatttggagaagcttcagagattggtggag
tgtgagggttgctctgtttccgaaaccgatggtcttggctactatgccctccagtgggcc
gctctcaacaaccgcactgccgccgcccagtatattattgagcatggaggagatgtgaat
gccgcagatcatacggggcagacagcattacactggagtgcggtgcggggtgcaatccag
gttgcggagctattactgcaagagggtgctcgggtgaatgctgtcgatatgtatggctat
cagacaacacatgttgcggctcaatatggtcagacagctttcctgtaccatattgtttca
aaacggaatgctgaccctgatgtgcctgataatgatgggagaagccctttacactgggct
gcttataaaggttttgctgattgcatacgtcttcttttatttctggatgcatacaaagga
cgccaagataaagagggttgcactcctttgcattgggctgctatcaggggtaacttggag
gcatgtacagtgttggtacaggctggaaagaaggacgacttaatggttacagacaacact
ggccttacaccagcacaacttgccgctgataagaatcacagacaagttgcctttttcctt
gggaatgctagaagactgcttgacaaacgctgcgatgggaatagtcgtcttggaggagtt
tcaaaactaggacttgcgccactactttggtgtataatctttgtgctgctggtgacctat
actcattctgtcattatggcaccaagtctgccaaaattaacagctggatcagtttttgtt
gcatggctaggagttttcctagcaacatccgggcttgttatgttctatagatgcagcagc
aaggatccaggttacatccgaatgaatgtccatgattcacaaaatatgaaagatgatgag
cctcttttgaagattgagataaataatcctgccttgctagctggtaattggtctcagctc
tgtgcaacgtgcaagattgtcaggcctcttcgtgcaaagcactgtccaacttgtgatcgt
tgtgttgaacaatttgaccaccattgcccctgggtatccaattgcattggcaagaaaaac
aaatgggatttctttgctttccttgttctggaagttttggcgatgctgtttactggaggg
gttactcttatgagagtttcgagcgatccattgtgtccatcttcttttggagcatggatc
aattttgttgctactagacatgtgggtgctctttcattttttataatggatttcttcctc
ttctttggcgtggcggttttgaccgttgtccaagcttctcagatatcacggaatattaca
acaaacgaaatggcaaacatgatgcgctataactaccttagaggcccaggtggtgggttc
agaaatccattcgatcacggaataaggaagaattgttcggatttcttggtcaagggttac
aacgaagatgtggaacacattgaagaaccggctcatgatgaggagggaattggaatgagg
gatataaattcttcaaacttgcagaaaggggacgcctattctcaccgcagaaacggcaac
agtcacgttgcaatcgatgtaaattctaattcgacaccacatcacggtcacgttcattct
gcccattgcagccatagtaacaaccacgggaaatcgaaaactgaaaacgttccagtagga
ttgggtcttggcctgggacggaacagtgcccggtctgttgtagcttcatga

DBGET integrated database retrieval system