KEGG   Pyrus x bretschneideri (Chinese white pear): 103955169
Entry
103955169         CDS       T03446                                 

Definition
(RefSeq) delta(14)-sterol reductase-like
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Pathway
pxb00100  Steroid biosynthesis
pxb01100  Metabolic pathways
pxb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    103955169
Enzymes [BR:pxb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     103955169
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 103955169
NCBI-ProteinID: XP_009365320
Position
Unknown
AA seq 369 aa
MDLGHLLHLLIPSWNSVAILALFFTYLAIAGPILPGKLVPGATLPDGSRLHYRCNGLLSL
LVLVGLLGVGAKMDIVSLNAISDRGLELLSTTFLFSVLVTLVLYAAGCKSTNQGSSLKPH
VTGNLLDDWWFGIQLNPQFMGIDLKFFFVRAGMMGWLFINLSVLARSVQDGTFSQSMILY
QLFCALYILDYFVHEEYMTSTWDIIAERLGFMLVFGDLVWIPFTFSIQGWWLLSNKMELG
TAAVIANCLTFLIGYLVFRGANKQKHVFKKNPKAPIWGKPVRVIGGKLLASGYWGIARHC
NYLGDLLLALSFSLPCGISSPVPYFYPIYLLILLIWRERRDEARCAEKYREIWAEYCRLV
PWRILPYVC
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggatctgggtcatcttctccatctcctaattccctcatggaactctgttgctattctg
gcattgttcttcacttacttggccattgctggaccgatactgcccggaaaacttgtcccc
ggtgccactttaccggacggctctcggcttcattatcgatgcaatggtctactatcactt
ctggtgctggttgggcttcttggtgttggcgctaagatggatatcgtgtcgcttaatgca
atatcagatagaggactagagctgttatcaacaacttttctgtttagtgttctggtcaca
ctggtactttacgctgcgggctgcaagtcgaccaaccagggttcttccctaaagcctcat
gtcacagggaaccttcttgatgactggtggtttggaatacagcttaatcctcagtttatg
ggcattgacctcaaatttttctttgttagagctggaatgatgggctggctatttatcaac
ctttcggttctcgccagaagtgttcaagatggtacctttagtcaatcaatgatcctctat
cagttgttctgtgcgttatacatcttggactactttgttcatgaggagtacatgacctcc
acatgggatataatcgcagagagactgggcttcatgctggtatttggagatctagtctgg
attccgtttactttcagcatccagggatggtggcttctgagtaacaagatggagttagga
acagcggctgtcatagcaaattgcttgacttttctgattgggtacctagtattccgagga
gccaacaagcaaaagcatgtctttaagaagaatccgaaagcacccatatggggtaagccc
gtgagggtcattgggggaaagttgcttgcttctggttattggggaattgcgaggcactgt
aattacctcggcgacttgttactagcactgtctttcagcttaccttgcgggataagttcc
ccagttccatacttctatccaatttatcttcttattctgctcatatggagagaaagaaga
gatgaagctcgttgtgccgagaagtacagagagatctgggccgaatactgccggcttgtt
ccgtggagaatattaccttacgtttgctaa

DBGET integrated database retrieval system