KEGG   Pyrus x bretschneideri (Chinese white pear): 103963201Help
Entry
103963201         CDS       T03446                                 

Definition
(RefSeq) non-specific phospholipase C1-like
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Pathway
pxb00562  Inositol phosphate metabolism
pxb00564  Glycerophospholipid metabolism
pxb00565  Ether lipid metabolism
pxb01100  Metabolic pathways
pxb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    103963201
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    103963201
   00565 Ether lipid metabolism
    103963201
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:pxb02042]
    103963201
Enzymes [BR:pxb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     103963201
Bacterial toxins [BR:pxb02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   103963201
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phosphoesterase
Motif
Other DBs
NCBI-GeneID: 103963201
NCBI-ProteinID: XP_009374252
Position
Unknown
AA seq 532 aa AA seqDB search
MAFRRKPIAWALFFFYLLLVSTQFIAARKTPKIKGPIKTVVVVVMENRSFDHIFGWLKST
RPDIDGLNGNESNPISVSQPGSARVRVSNDAFFIDSDPGHSFQAIREQIFGSNESSENPA
PMNGFAQQAESMGEGMARTVMSGFKPEVLPVYTGLANEFAVFDRWFASVPASTQPNRFYV
HSATSHGAMSNVRKDLIHGFPQKTIFDSLDENGLDFGIYYQNIPATLFFNSLRKLKHVMK
FHSYALTFKLHARLGKLPNYAVIEQRYFDVKELPANDDHPSHDVARGQRFVKEVYETLRA
SPQWKEMALLITYDEHGGFYDHVPTPVSGVPSPDGIEGPDPYYFRFDRLGVRVPTILVSP
WVEKGTVIHEPTGPKPHSQFEHSSIPATVKKLFNLKSNFLTKRDAWAGTFENYFTLRSTP
RDDCPETLPEVTTSLRPGGPREDSSLSEFQVELIQLASQLNGDHVLNTYPNIGETMTVRE
ANIYAEDAVKRFLEAGRAALKAGANESAIVTMRASLTSRVNAQGHSSYLETQ
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggctttccggcgaaaacccatcgcctgggctctctttttcttctacctcttgttggtc
tccacccaattcattgcggcgcgcaaaacccccaaaatcaaagggcctatcaaaacggtc
gtcgtcgtcgtcatggaaaaccgctcctttgaccacatctttggctggctcaagtcgacc
cgacccgacatcgacggcctgaacgggaacgaatcgaacccgatttccgtctcgcaaccc
ggctcggctcgagtccgcgtctcaaacgacgcctttttcatcgactccgacccgggtcac
tcgtttcaggcgattagggaacagatattcgggtcgaacgagagctccgagaacccggct
ccgatgaacgggttcgctcagcaggcggagagtatgggcgaggggatggcgaggacggtg
atgagcgggttcaagccggaagtcctcccggtctacaccgggttagcaaacgagttcgcc
gtgttcgaccggtggttcgcgtccgtgccggcgtcgactcagcccaaccggttctacgtc
cactcggccacgtcacacggcgccatgagcaacgtccgcaaggacctcatccacggcttc
cctcagaaaacgatcttcgactctctggacgaaaatggcctcgacttcggcatttattac
cagaacatccccgccacgctcttcttcaacagcctgaggaaactgaagcacgtgatgaaa
ttccacagctacgcgctgacgttcaagctgcacgcgcggctcgggaagctgccgaactat
gcggtgatcgagcagcggtacttcgacgtcaaggagcttcccgccaacgacgaccacccg
tcgcatgacgtggcgcgcgggcagaggttcgtgaaggaggtgtacgagacgctgagggct
agcccgcagtggaaagaaatggcattgctgattacttacgacgagcacggcgggttttac
gaccacgtgccgacgccggtttcaggtgtgccgagcccggatgggatcgaggggcccgac
ccgtattatttccggtttgaccggttgggtgtgcgggtgccgaccatactcgtctcgccg
tgggttgaaaagggtaccgtgatccatgagccaacagggccgaaaccacattcccaattt
gagcattcttccatccctgccactgtgaagaagctattcaatttgaaatcaaacttcttg
acaaagagagatgcatgggctggtacttttgagaattattttaccctccgcagcactcct
cgtgatgactgtccagaaactcttccagaggtgacaacctcactgaggccaggcggaccc
agagaagattcgagcctctcagagttccaagtcgagcttatccagcttgcatcccagctc
aatggcgatcacgtcctcaacacctaccctaatattggagagaccatgacagtgcgtgaa
gcaaacatttacgcagaggatgcagtcaagaggttcctggaagccggaagagctgctcta
aaagccggagcgaacgagtctgcaattgttacgatgagagcttcgctcaccagccgagtt
aacgcacaaggtcatagctcctacctagaaactcagtga

DBGET integrated database retrieval system