KEGG   Pyrus x bretschneideri (Chinese white pear): 103965769Help
Entry
103965769         CDS       T03446                                 

Definition
(RefSeq) UDP-glucuronic acid decarboxylase 1-like
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Pathway
pxb00520  Amino sugar and nucleotide sugar metabolism
pxb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    103965769
Enzymes [BR:pxb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     103965769
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD NAD_binding_4 RmlD_sub_bind Polysacc_synt_2
Motif
Other DBs
NCBI-GeneID: 103965769
NCBI-ProteinID: XP_009377117
Position
Unknown
AA seq 433 aa AA seqDB search
MMKQLHKQSSVNHRRDEETPSTLSSPYSPKALKHPRSLPRSINYLFKEQRLLFILVGILI
GSTFFILQPTLSRLGPSDPNSAINTVSRSFSTAHDLVSKPTHAKVGRVPVALGKRRLRIV
VTGGAGFVGSHLVDKLLDRGNDVIVIDNFFTGRKNNLVHHFGNPRFELIRHDVVEPVLLE
VDQIYHLACPASPVHYKYNPVKTIKTNVMGTLNMLGLAKRIGARFLLTSTSEVYGDPLEH
PQKETYWGNVNPIGERSCYDEGKRTAETLAMDYHRGADVEVRIARIFNTYGPRMCLDDGR
VVSNFVAQAIRKQPLTVYGDGKQTRSFQYVSDLVNGLMALMDGEHVGPFNLGNPGEFTML
ELAEVVKETIDSSATIEFRPNTADDPHKRKPDISKAKELLNWEPKVSLREGLPLMVSDFQ
NRILNEDEGKGIN
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagcaactgcacaagcaatcgagcgtgaaccaccggcgcgacgaagagacccca
tctaccctaagctctccctactcccccaaagctctcaagcacccccgatcactccccaga
tccatcaactacctcttcaaggagcagcgcctcctcttcatcctcgtcggcattctcatc
ggctccaccttcttcatcctccagcccaccctctcccgcctcggtccctccgatcccaac
tccgccatcaacaccgtctccagatccttctccaccgcccacgacctcgtctccaagccc
actcatgccaaggtcggtcgcgtccctgttgccctcggcaagcggaggctccgcatcgtc
gtcaccggcggagctgggttcgtcgggtcccacctcgttgacaagctccttgacagaggt
aatgatgtgattgtgattgataatttcttcactgggaggaagaacaatctggtgcatcat
ttcgggaacccgaggttcgagctcattcggcacgacgtcgtcgagccggttctgttggag
gtggatcagatctaccatttggcttgccctgcctcccctgttcattacaagtataaccca
gtcaagacaattaagaccaatgtgatgggtacccttaatatgctgggacttgccaagcga
attggggcacggtttttgcttactagtaccagtgaggtttatggcgatccgctggagcat
cctcagaaggagacttattggggaaatgtgaatcctataggtgagaggagctgttacgat
gaaggaaagaggacagcagagacattggcaatggattatcatcgaggtgcagatgttgag
gtgcgtattgctcgaattttcaacacttatgggccgcgtatgtgtttagatgatgggcgt
gtggttagcaattttgttgctcaggctatccgcaaacaaccattgactgtgtacggtgat
ggtaaacaaacacgaagcttccaatatgtctctgatttggtcaatggactgatggcattg
atggatggagaacatgtcggacctttcaacctgggtaatccaggggagttcactatgcta
gagcttgccgaggttgtcaaagaaacaattgattctagtgcgaccatagaattcagacca
aacactgctgatgatccacacaagaggaagcccgatattagcaaagccaaggagttattg
aactgggagccgaaagtctcactgagggaaggactgcccctaatggtgagtgatttccag
aatcgcattctaaatgaagatgaaggaaaagggattaactaa

DBGET integrated database retrieval system