KEGG   Pyrus x bretschneideri (Chinese white pear): 103965830Help
Entry
103965830         CDS       T03446                                 

Definition
(RefSeq) isocitrate dehydrogenase [NADP]-like isoform X1
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Pathway
pxb00020  Citrate cycle (TCA cycle)
pxb00480  Glutathione metabolism
pxb01100  Metabolic pathways
pxb01110  Biosynthesis of secondary metabolites
pxb01200  Carbon metabolism
pxb01210  2-Oxocarboxylic acid metabolism
pxb01230  Biosynthesis of amino acids
pxb04146  Peroxisome
Module
pxb_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    103965830
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    103965830
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    103965830
Enzymes [BR:pxb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     103965830
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 103965830
NCBI-ProteinID: XP_009377196
Position
Unknown
AA seq 483 aa AA seqDB search
MLRARPRLSAMSGTAMMSSSSATSSAAMRDPRLSSSSSPRLFNGVPVGNRVSFAARFSRT
SLRCFASAASFDKVRVQNPIVEMDGDEMTRIIWKTIKDKLIFPYLDLDIKYYDLGILNRD
ATDDRVTVESAEAALKYNVAVKCATITPDETRVKEFGLKSMWRSPNGTIRNILDGTVFRE
PILCKNIPRIVPGWKKPICIGRHAFGDQYRATDTVIKGPGKLKMVFVPEGGDAPVELDVY
NFKGPGVALSMYNVDESIRAFADSSMSLALSKKWPLYLSTKNTILKKYDGRFKDIFEEVY
VEKWKQKFEENSIWYEHRLIDDMVAYALKSEGGYVWACKNYDGDVMSDLLAQGFGSLGLM
TSVLLSSDGKTIEAEAAHGTVTRHFRLHQKGQETSTNSIASIFAWTRGLEHRAKLDKNDR
LLDFVRKLEAACIETVEGGKMTKDLALLIHGPKVSREYYLNTEEFIDAVAKNVEKKLLEP
VAV
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgctaagagcgcggccgcgactgagcgccatgtcgggcactgcaatgatgtcgtcatcg
tcggctacgtcgtccgcggccatgagagaccccagattgtcctcttcttcgtccccgagg
ctcttcaatggagtgcctgtcgggaaccgcgtctccttcgccgcccgcttcagccgcact
tcgctgcggtgcttcgcttctgccgccagtttcgataaagttcgggtgcagaatccgatt
gtcgaaatggacggtgatgaaatgacgaggatcatatggaaaacgattaaagacaaactt
atttttccctatctggatttggatataaagtattacgatttagggattttgaaccgtgat
gctaccgatgacagagttacagtagagagtgctgaagcagctcttaagtataacgttgct
gtgaaatgcgctactattactcctgatgagaccagagtgaaggaatttgggctgaaatca
atgtggaggagtcccaatggcacaattagaaacattctagacggtactgttttccgtgaa
cctatcctatgtaaaaacatccctagaatagttcctggttggaagaaacccatatgtatt
ggtaggcatgcctttggcgatcagtatcgagccactgatacggttattaaaggaccagga
aaacttaaaatggttttcgtcccagaaggaggagatgcccccgtggaacttgatgtttat
aatttcaaagggcctggtgtggccctttctatgtataatgttgatgagtctattcgagct
tttgctgactcgtcaatgtcgttggctctttccaagaagtggccgctatacttgagcact
aaaaacactattcttaaaaaatacgatggcaggtttaaggacatatttgaggaggtttat
gttgagaaatggaagcagaagtttgaagaaaattctatatggtatgaacaccggctaata
gatgacatggtggcttatgcactcaaaagtgagggtggatatgtttgggcttgcaaaaat
tatgatggagatgttatgagtgatttgcttgctcaaggatttgggtctttgggcctcatg
acttctgtgttgttgtcctcagatggcaagacaatagaagctgaagcagctcatgggaca
gtaactcgtcattttcggttacatcagaaaggacaagaaacaagtacaaatagtattgct
tcaatatttgcatggacacgaggcctagaacacagggcaaaattagataaaaatgatagg
ttgctggattttgttcgcaagttggaggctgcgtgcattgagaccgtggagggtggaaag
atgaccaaggatctcgcccttttgatccatggccccaaggtatcaagggagtattacttg
aacaccgaagaattcattgacgctgtcgcaaagaatgttgagaaaaagcttctggaacct
gtagcagtttaa

DBGET integrated database retrieval system