KEGG   Pyrus x bretschneideri (Chinese white pear): 103967012Help
Entry
103967012         CDS       T03446                                 

Definition
(RefSeq) acyl-coenzyme A oxidase, peroxisomal-like
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Pathway
pxb00071  Fatty acid degradation
pxb00410  beta-Alanine metabolism
pxb00592  alpha-Linolenic acid metabolism
pxb00640  Propanoate metabolism
pxb01040  Biosynthesis of unsaturated fatty acids
pxb01100  Metabolic pathways
pxb01110  Biosynthesis of secondary metabolites
pxb01200  Carbon metabolism
pxb01212  Fatty acid metabolism
pxb04146  Peroxisome
Module
pxb_M00087  beta-Oxidation
pxb_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    103967012
  09103 Lipid metabolism
   00071 Fatty acid degradation
    103967012
   00592 alpha-Linolenic acid metabolism
    103967012
   01040 Biosynthesis of unsaturated fatty acids
    103967012
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    103967012
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    103967012
Enzymes [BR:pxb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     103967012
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_dh_M Acyl-CoA_dh_1 Acyl-CoA_dh_N
Motif
Other DBs
NCBI-GeneID: 103967012
NCBI-ProteinID: XP_009378530
Position
Unknown
AA seq 689 aa AA seqDB search
MQSPDPTAEDESQAVSRRIQRLSLHLTPNYPFPRNDAAQRLELVECASKAAKLTVDTSSL
SNYMRGKHREIQDRVLDYFNKRPELQTPVEILKDDHRELCMKQLVGLVREAGIRPFRYVV
DDPAKHFAILEAVGSVDMSLGIKMGVQYSLWGGSVLNLGTKKHKDKYFDGIDNMEYPGCF
AMTELHHGSNVQGIQTVAAFDPLTDEFIIDTPNDGAIKWWIGNAAVHGKFATVFAKLMLP
THDTKGITDMGVHAFIVPIRDFKSHQTLPGIEIHDCGHKVGLNGVDNGALRFCSVRIPRD
NLLNRFGDVSRDGKYTSSLPSINKRFAATLGELVGGRVGLAYSSVSVLKIAATIAIRYSL
LRQQFGPPKQPEVSILDYQSQQHKLMPMLASTYAFHFATLHLVEKYSEMKKFHDEQLVGD
VHSLSAGLKAYVTAYTAKSLSICRESCGGHGYAAVNRFGSLRNDHDIFQTFEGDNTVLLQ
QVAGDLLKQYKEKFQGGTLTVTWNYLRESMNSYLSQPNPVTARWESEEHLRDPKFQLDAF
RYRTSRLLQSVAVRLRKHSKTLGSFGAWNRCLNHLLTLAESHIESVILAKFVEAVQKCPD
PSSQAALKLVCDLYALERIWKDIGTYRNVDYVAPNKAKAIHKLMEYLSFQVRNIARELVD
TFDIPDYVTRAPIAMQSDAYSHYTHYVGF
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagcccagatccaacggcggaggacgaatcccaggccgtcagccgccgcatccaa
cggttgtccctgcacctgacccccaattacccatttccccgaaacgacgcagctcagcgg
cttgagctggtggagtgcgcttccaaggcggcgaagctgacggtggacacaagcagcctc
tcaaactacatgagaggcaagcaccgggaaatccaggacagagtgttggattacttcaac
aagcggccggagcttcagaccccggtggagattttgaaggacgaccaccgggagctttgc
atgaagcagcttgtggggttggtgagagaggctgggatcaggcctttccggtacgtcgtc
gatgacccggctaagcactttgctattttggaggccgttggcagcgtcgacatgtctctc
gggattaagatgggggtgcagtacagtctttggggaggttctgtgcttaatttaggaacc
aaaaagcacaaggataaatattttgatggtatcgacaatatggagtatccaggttgtttt
gctatgaccgaactacatcatggctcaaatgttcaaggtatacaaacagtggcagctttt
gatccactcacagatgaatttataatcgacacacccaatgatggggccatcaaatggtgg
attggcaatgctgccgttcatggaaagtttgctactgttttcgctaagctgatgttgccg
actcatgacacaaagggtattactgatatgggtgtccatgccttcattgtgccaataagg
gatttcaagtcccaccaaactcttccaggaattgagatacatgattgtggccacaaggtt
ggtctgaatggggtagacaatggagcattaagattctgctcagttagaatccctcgtgat
aatcttcttaatcggtttggagatgtctcccgggacgggaagtacacaagtagtttacca
tctataaataaaagatttgctgccactctaggtgaacttgtaggtggaagggtcggtctt
gcatattcttcagttagtgtcctgaagattgctgccacaattgcaatccgatattctcta
ctgcgccagcagtttggtcctcccaagcaacctgaagttagtattcttgattatcagtct
caacaacacaagttaatgcccatgctggcttcaacttatgcattccattttgccacgttg
catttggtggagaaatattcagagatgaaaaagtttcatgatgaacaattggttggtgac
gtccattcgctttcagcagggctcaaggcttatgtgacagcatataccgcaaagtcatta
agtatctgcagggaatcttgtggaggccatgggtatgctgctgtcaaccgcttcggtagc
ctgaggaatgaccatgacatttttcagacgtttgagggggacaatacagtgcttctacaa
caggttgcgggtgatctgttgaagcaatataaggagaaatttcaaggcgggacactcact
gtcacatggaactacctcagagagtccatgaactcatatctatctcagccaaatccagtg
actgctcgatgggaaagtgaagagcatttgcgagatcctaagttccagttggatgctttc
agataccgaacttctcgattacttcaaagtgttgcagtaagactgcgcaagcattccaaa
actcttggcagttttggtgcatggaatcgatgcttaaatcaccttttgactctagcggag
tcccatattgagtctgtcatccttgccaagtttgttgaagctgtccagaaatgtccggat
ccaagttctcaagctgctctgaaactcgtctgtgatctttatgcactggagcgcatttgg
aaagacataggaacctatcgtaatgttgattatgttgcaccaaacaaagctaaggcaatt
cacaaactgatggagtacctgagtttccaggtgagaaatatagcaagggaacttgtagac
acatttgacattccagattatgtcacaagagccccaattgcaatgcagtcggatgcctac
tcacactacacacactacgtcggattttaa

DBGET integrated database retrieval system