KEGG   Pyrus x bretschneideri (Chinese white pear): 108867313Help
Entry
108867313         CDS       T03446                                 

Definition
(RefSeq) probable mediator of RNA polymerase II transcription subunit 37c
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Pathway
pxb03040  Spliceosome
pxb04141  Protein processing in endoplasmic reticulum
pxb04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:pxb00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    108867313
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    108867313
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    108867313
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pxb01009]
    108867313
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pxb03041]
    108867313
   03009 Ribosome biogenesis [BR:pxb03009]
    108867313
   03110 Chaperones and folding catalysts [BR:pxb03110]
    108867313
   04131 Membrane trafficking [BR:pxb04131]
    108867313
   03051 Proteasome [BR:pxb03051]
    108867313
   03029 Mitochondrial biogenesis [BR:pxb03029]
    108867313
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pxb04147]
    108867313
Protein phosphatases and associated proteins [BR:pxb01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     108867313
Spliceosome [BR:pxb03041]
 Complex B
  Other components
   Prp19 complex
    108867313
 Complex C
   Prp19-CDC5 complex
    108867313
Ribosome biogenesis [BR:pxb03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    108867313
Chaperones and folding catalysts [BR:pxb03110]
 Heat shock proteins
  HSP70 / DNAK
   108867313
Membrane trafficking [BR:pxb04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    108867313
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    108867313
Proteasome [BR:pxb03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    108867313
Mitochondrial biogenesis [BR:pxb03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    108867313
Exosome [BR:pxb04147]
 Exosomal proteins
  Proteins found in most exosomes
   108867313
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 Radial_spoke_3 AAA_11 Acetate_kinase Laminin_I UPF0242 DUF763 ApoO DUF883 eIF-4B PCRF O-antigen_lig Membralin
Motif
Other DBs
NCBI-GeneID: 108867313
NCBI-ProteinID: XP_018503255
Position
Unknown
AA seq 195 aa AA seqDB search
MYTFTFGQETPKQLLGKIRVYEGEERVKRQGLAITTSWENSSFLAFLLLQGGVPQITVCF
DIDANGILNVSAKDKTTWKKNKITMTKDKGRLSKEEIEKMAQEAEKYKSVDEKHKKKVEA
KNALENYAHDMRKVLEDYASNMRKKIEKINDEIDQAMPWLDGNQLAEADEFEYKKKELES
ICDPISAEMYQETGC
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgtatactttcacatttggccaagaaacaccgaaacaacttcttgggaaaattcgagta
tatgagggtgaagagagggtgaagagacaaggactcgcgataacaacttcttgggaaaat
tcgagctttctggcattcctcctgctccaagggggtgttccgcaaatcactgtctgcttt
gatattgatgccaacggtatcttgaatgtctctgctaaagacaagactacatggaagaag
aacaagattaccatgaccaaggacaagggaagattgtcgaaggaagaaatagagaagatg
gcccaagaggctgagaagtacaagtcagtagatgagaagcacaagaagaaggtggaggcc
aagaatgctttggagaattatgcccacgacatgaggaaggttttggaggattatgcctcc
aacatgaggaaaaagattgagaagatcaatgatgagattgaccaggccatgccatggctt
gacggaaaccagcttgctgaggctgacgagtttgagtacaagaagaaggagctggagagc
atctgcgatccgatcagtgccgagatgtaccaagaaacagggtgctga

DBGET integrated database retrieval system