KEGG   Paenibacillus xylanexedens: BS614_00830Help
Entry
BS614_00830       CDS       T04676                                 

Definition
(GenBank) beta-glucosidase
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
pxl  Paenibacillus xylanexedens
Pathway
pxl00460  Cyanoamino acid metabolism
pxl00500  Starch and sucrose metabolism
pxl01100  Metabolic pathways
pxl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pxl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BS614_00830
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    BS614_00830
Enzymes [BR:pxl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     BS614_00830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3_C Glyco_hydro_3 Fn3-like CBM_6 DUF5010_C RicinB_lectin_2 CARDB Lipase_GDSL
Motif
Other DBs
NCBI-ProteinID: APO42769
UniProt: A0A1L5LH99
Position
complement(227408..230230)
Genome map
AA seq 940 aa AA seqDB search
MTTNQTKYPFQDTALELDTRVKDLVSRLKEDEKIESMLQYQPAVDRLGVPAYKHGTEAAH
GLAWLGEATSFPQPVGLACTWDADLMKEIGSVLGDEARVFYKRNPAVNGLTLWAPTVDME
RDPRWGRNEEAYGEDPELTAELTTALVKGIQGDHPKYYKAVATLKHFLANNNEVDRGSGS
SSIDPRNMREYYLKAFEKPFKEGGAQSMMTAYNSINGTPALLHPFVNEIVKGEWGMDGFI
VSDAGDVMGIKNDHKYYDSHTPGTVESVKAGIDSITDDAELSKQALREGLAQGTLTMDDI
DKALFNTFRVRFRLGEFDPEEGNPYAAIGEESMMTEKAKELSLRAAREQVVLLKNDKYTL
PLDKTRAGKVAVIGQLGGTVYRDWYAGTMPYNVSPLEAIRGKVGSDKVAFKDGNDRITLT
SVANGKKIGLAEGEKSPVIASGEAETFMVSDWGFGSYTLQAESNGKYLTTDEETVTASAD
EVYGWFVKEVFHLLPQQDGSVGLTTWNGKTVTAPNGGNDAFVVSEELKSFGATETFKQDI
IVNGLEEAVAAAKAAETAIVFVGNNPLVNGKEEIDRPSLDLAESQQRLVEAVYAANPNTV
VVIVGSYPFTSNWVQENIPAVLYTSHAGQELGNAVADVLYGDYAPAGRLNMTWVQSADQL
TDIKDYDIIQSGRTYQYFEGNVLYPFGHGLTYATFKYSNLQLSPTQVGTEGNVTVTVDVT
NTGSMASDEVVQLYVRAGKSRVKRPLKTLKGFRRLHIEAGATAKVSFTLPVQELAIWDVT
RDRYVVESGTYSIMVAKSSSDVQLVADLTVEGETIPARNLGVATRAENYDAYLGVDLDES
KEGGSAVRVVGEQGWIAFKDADLGSGAAAIEARVSAEKAGAVLEVRLGSPDGTLAGRVEL
AQGEAQQWSTVKAELTGASGAQDVYIVLSAGVRISHFEIR
NT seq 2823 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccaaccaaacgaaatatccgtttcaagatacagcactagaattagacacccgg
gtgaaggaccttgtatcccgcttgaaggaagatgaaaaaattgaatccatgctgcaatat
cagccggcagtagaccgcctgggtgtgcctgcatataaacatggaacagaagcggcacac
ggcttggcctggcttggagaagcaacatccttcccacaaccggtggggcttgcatgcaca
tgggatgcggatctgatgaaagagattggctccgtgctcggagacgaggcgcgtgtattt
tataaacgaaatccggcagtgaacggtcttacgctgtgggcacctacagtggatatggaa
cgtgacccgcgctggggaaggaatgaagaggcgtatggtgaagacccggaactgacagcc
gagctgacaacagcattggtcaaaggaattcagggcgaccatccaaagtattacaaagcg
gtcgctaccttgaagcatttcctcgccaataataacgaagtggatcgcggaagtggttcg
tccagcattgatccgcgcaatatgcgtgaatattatctgaaagcgttcgagaagccgttc
aaagaaggcggcgcacagtcgatgatgacggcgtacaactccattaatggtacaccagcg
ttgttgcatccttttgtgaacgagattgtcaaaggtgaatggggcatggatggtttcatt
gtcagtgatgcaggcgatgtaatgggcatcaagaacgatcataaatactatgattcccac
acaccaggtacggtagaatctgtgaaggcaggaattgatagcatcaccgatgatgctgag
ctgtccaaacaggcactacgtgaaggattggcacaaggcacactcacgatggatgacatc
gacaaagcgttgtttaatacgttccgtgtgcgtttccgtctgggcgagttcgatccggaa
gaaggcaacccgtacgctgctattggtgaagagtccatgatgacagagaaagcaaaagaa
ctgtcgctcagagccgcaagagaacaagtggtgttgctcaaaaacgacaaatacacgctc
ccgctggacaaaacaagagctggtaaagtggctgtgattggtcaattgggcggaaccgtc
tatcgtgactggtatgcaggcaccatgccgtataacgtatccccacttgaggcgatccgt
ggcaaagtaggcagcgacaaagtggcgttcaaggatggtaatgatcgcattacgttaact
tccgtagccaatgggaagaagattggactggcggaaggtgagaaatcacctgtcattgct
tcgggagaagcggagacatttatggtttccgactggggcttcggaagttataccttgcag
gcggaaagcaacggcaaatatctgaccacagatgaagagaccgtaacggcttccgctgat
gaagtatacggctggttcgtgaaggaagtattccacttgttgccacaacaggacggaagt
gtaggtctgaccacttggaatggcaaaacggtgactgcacctaatggtggaaacgatgca
ttcgtagtgtccgaagaactgaagtctttcggtgctacagagacattcaagcaggatatc
attgtaaatggacttgaggaagcggtagcagctgccaaggctgcggaaacggcaattgtc
tttgttggtaataatccgcttgtaaatggtaaagaagaaattgaccgtccaagtctggat
ctggctgaatcgcagcaacgtctggttgaggcggtctatgccgcgaacccgaacacggtt
gtggtcatcgtgggtagttatccgttcacatcgaattgggttcaggagaacatcccggcg
gtattgtatacttcgcacgcaggacaggaactgggtaacgcagtggctgacgttttgtat
ggcgactatgcgccagcaggccgtttgaacatgacatgggtacaatcggcagatcaactg
accgacatcaaagattacgatatcattcaatccggtcgcacgtatcaatattttgaaggt
aatgtattgtatccgtttggacatggtctgacgtatgcaacgtttaaatacagcaatttg
caacttagcccaactcaagtgggtacagagggcaacgttacggtaactgtggatgtgact
aataccggttcaatggctagcgacgaggttgtacagttgtatgttcgtgcaggcaaatcc
cgggtgaaacgtccactcaaaacgttaaaaggattccgtcgtcttcatatcgaagcggga
gctacagcgaaagtcagcttcaccttgcctgttcaggaactggcaatctgggatgtaact
cgtgatcggtatgtcgtggaaagtggaacttactccatcatggttgccaagtcatcctct
gatgtccaactggttgcagacctgacggtagaaggagagacgatccctgcccgtaatctg
ggtgtggctactcgtgccgagaattatgatgcttacctgggtgttgacctggatgagagc
aaagagggcggaagtgctgtccgtgtagttggtgagcaaggatggattgcctttaaggat
gccgatctgggtagtggggcagcagcaattgaagctcgtgtatccgcagaaaaagcaggc
gctgtgttggaagttcgactcggttcaccagacggtacgctcgcaggtcgtgtggaactg
gcacaaggtgaagcccagcagtggtctaccgtgaaggcggaactcacaggtgcatcaggt
gcgcaggatgtatacattgtgctgtcagcaggtgtgcgcatcagtcacttcgagatccgt
tag

DBGET integrated database retrieval system