KEGG   Paenibacillus xylanexedens: BS614_03605Help
Entry
BS614_03605       CDS       T04676                                 

Definition
(GenBank) arginine--tRNA ligase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
pxl  Paenibacillus xylanexedens
Pathway
pxl00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:pxl00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BS614_03605
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pxl01007]
    BS614_03605
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pxl03016]
    BS614_03605
   03029 Mitochondrial biogenesis [BR:pxl03029]
    BS614_03605
Enzymes [BR:pxl01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     BS614_03605
Amino acid related enzymes [BR:pxl01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   BS614_03605
Transfer RNA biogenesis [BR:pxl03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BS614_03605
 Prokaryotic Type
   Other AARSs
    BS614_03605
Mitochondrial biogenesis [BR:pxl03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BS614_03605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DALR_1 tRNA-synt_1d Arg_tRNA_synt_N tRNA-synt_1e tRNA-synt_1g tRNA-synt_1 tRNA-synt_1f tRNA-synt_1b
Motif
Other DBs
NCBI-ProteinID: APO43234
UniProt: A0A1L5LIN9
Position
844852..846531
Genome map
AA seq 559 aa AA seqDB search
MTRNPLDTINERVSTAIGNAIVTAGIVTQDELPAITLEVPREKTHGDLATNAAMQLTKIA
KRNPRQIAEEIIANLNLAEAGIEKAEIAGPGFINFKLDKSYLYPVLALVQEQGKDYGRIN
IGEGRKVEMEFVSANPTGSLHLGHARGAAVGDALCNILDYAGYDVTREYYINDAGNQVFN
LARSIEARYLQELGQDAEMPEDGYHGEDIKGFAKQLVAEKGEELLSMHPGDRAAYFRDFG
LEKELDKIKRDLNRFRVNFDIWFSETSLYDNGEVLRVLDELRDRNEIYEQDGATWLKTMQ
YGDDKERVLIKNDGTYTYLTPDIAYHRDKYARGYDTMINIWGADHHGYIPRMKAAMQALG
NDPEKLVVLIAQMVSLFQNGEKVKMSKRTGKAVTMEDLMDEVGIDAIRYFFTMRSMDSHL
DFDMDLAISTSNENPVFYVQYAHARVCSVYRQAEEQGIELLPLAQIDLSKLTTEHEYDLL
RKMGELPEEISAAATGYAPHRIIRYVYELASLFHSYYRAERVITEDTQQTQARLALIGAV
RTVIATALRLVGVTAPDKM
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgacacgtaatccactagatacgattaacgaacgggtaagtacggccatcggcaacgcc
attgtgacggccggaattgttacgcaggacgaattgccagccatcacattggaagtgccg
cgtgagaagacacacggggacttggcgaccaatgctgccatgcagctgaccaagattgcc
aagcgtaatccgcgtcagattgcagaagagatcattgccaatctgaatctggctgaagcc
ggaatcgagaaggctgagattgcgggcccaggattcattaacttcaaattggacaagagt
tacctttatccagtacttgcgcttgtgcaggagcagggtaaagattacggaagaattaac
atcggagaaggacgcaaagtcgagatggagtttgtcagtgccaacccgacaggcagcctg
catctgggtcatgcccgtggagcagctgtaggtgatgcactatgtaacatccttgactac
gcaggatatgatgtaacccgtgaatactacattaatgacgcaggtaatcaggtgtttaat
ctggctcgttccattgaagctcgttatctgcaagagctgggtcaggatgctgagatgcct
gaagacggttatcacggtgaagatattaaaggattcgccaagcagcttgttgctgaaaag
ggtgaagagttgctgtccatgcatccgggtgaccgtgcggcttatttccgtgactttggt
ctggagaaggaactggacaagatcaaacgtgacttgaatcgcttccgtgttaactttgac
atctggttcagcgaaacttccctgtacgacaacggagaagtgctgcgagtgcttgatgaa
ttgcgtgatcgtaatgagatctatgagcaagatggagcaacttggttgaaaacgatgcag
tacggtgacgacaaagaacgtgtattgatcaagaacgatggcacgtatacttacctgacg
ccagatattgcttatcaccgcgacaaatatgctcgtggatacgacacgatgatcaacatc
tggggtgccgatcaccatggatatattccacggatgaaagccgcgatgcaagcactgggt
aatgaccctgagaaactggtggtcttgattgcacagatggtgagcttgttccagaacggt
gaaaaagtgaagatgtccaagcgtacaggtaaagctgtaacgatggaagatctgatggat
gaagtcggcattgatgccatccgttacttcttcacaatgcgcagcatggactcccatctg
gactttgacatggaccttgcgatttcgacatccaatgagaatccggtattctacgtacaa
tacgcgcatgcacgtgtatgcagtgtataccgtcaggctgaagaacaaggtattgaactg
ctgccactggcacagattgacctgtccaagctgacaacagagcacgagtatgaccttctc
cgcaaaatgggagagttgcctgaggaaatctcggcagcagcaacaggatatgcgcctcat
cgtatcatccgttatgtatacgagctggcatccctgttccacagctactaccgtgcagaa
cgtgtcattacggaagacacgcagcaaactcaagcacgtctggcactgatcggtgctgta
cgtaccgttatcgcaacagcgcttcgtctggtaggcgtaaccgctcctgacaaaatgtaa

DBGET integrated database retrieval system