KEGG   Paenibacillus xylanexedens: BS614_16350Help
Entry
BS614_16350       CDS       T04676                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
pxl  Paenibacillus xylanexedens
Pathway
pxl00480  Glutathione metabolism
pxl00590  Arachidonic acid metabolism
pxl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pxl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    BS614_16350
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BS614_16350
Enzymes [BR:pxl01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BS614_16350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: APO45431
UniProt: A0A1L5LPV9
Position
3625029..3625583
Genome map
AA seq 184 aa AA seqDB search
MSIFSYQVPFMEGHEGEFSAFKGKVLLIVNTASRCSYSRQFSELQQMYEKYGDLGLEILA
FPCNQFNDKEPGSSAEVAEYCRSQFQISFPILEKVEVVGQSMHPLFRYLIEEAPFQGYDL
DTKQGQWMDTFVKEKHPELYQGDGIKWNFTKFLIDRSGNVHGRYETTVAPLEMESAIQIL
LKKS
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgagtatattttcttaccaagttccgtttatggagggacacgagggtgaattttctgct
tttaaagggaaggtgctacttattgtgaatacagcaagtcggtgcagctactcccgtcaa
ttcagtgaacttcagcagatgtatgagaaatatggtgatctggggctggagattctggcg
ttcccgtgcaaccagtttaacgacaaagaacctggcagtagcgctgaggtagccgagtat
tgcagaagtcaatttcagatatcctttccgatcctcgagaaggttgaggttgtggggcaa
tcgatgcatccattgttccgttatctgattgaagaagcgccatttcaaggttatgatctg
gacacgaagcaaggtcagtggatggacacttttgtgaaggagaagcatccagaattgtac
caaggagacgggatcaaatggaatttcaccaaattcctgattgaccgcagtggaaacgtc
catggccgttatgaaacgacagttgctccattagagatggagtccgctattcagattctg
ttaaagaaatcataa

DBGET integrated database retrieval system