KEGG   Paenibacillus xylanexedens: BS614_17010Help
Entry
BS614_17010       CDS       T04676                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
pxl  Paenibacillus xylanexedens
Pathway
pxl00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:pxl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BS614_17010
Enzymes [BR:pxl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BS614_17010
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BS614_17010
    1.1.1.-  
     BS614_17010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C TrkA_N ADH_N_assoc 2-Hacid_dh_C Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: APO45550
UniProt: A0A1L5LQ88
Position
3790479..3791528
Genome map
AA seq 349 aa AA seqDB search
MKALRWHGVKDLRLENINEPHPEEGKVKIKVEWCGICGSDLHEYTAGPIFIPAQAPHPLT
GEQAPIVMGHEFSGQVVEVGEGVTRFKAGDRVVVEPIYACGHCEACKQGRYNLCDQMGFL
GLAGGGGGFSEYVTAAENMVHAIPDSISYEQGALVEPSAVALHAVRQSKLKVGDTAAVFG
AGPIGLLVIEALKASGASDIYVVELSDERKAKAEELGAIVIDPTQFNVVEEIHQRTQGGV
NVAYEVTGVPRVLQQAIDSTRIGGELMIVSIFEQEAPIHPNSIVMKERTVNGIIGYRDVF
PAVISLMDKGFFPADKLVTKRISLDEVVEHGFEALLKEKNQVKILVKAE
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattacgttggcatggagtcaaagatttacgtctcgaaaatattaatgaacct
cacccggaagaaggaaaggtcaaaataaaagtggaatggtgcggtatctgcggcagtgat
ttgcacgagtacacagcaggaccaatcttcattcccgctcaagcaccgcatccgctaaca
ggggaacaagcgcctatagttatggggcatgaattctcaggacaggttgttgaagtaggg
gaaggtgttacacgtttcaaggcaggcgatcgtgttgtggtagaacccatctatgcatgt
ggacactgcgaagcttgtaaacagggtagatacaatctgtgcgatcagatgggtttcctt
ggactcgctggaggcggaggaggattctccgagtatgtaactgctgcagaaaacatggta
catgccattccggattcaatctcgtatgagcaaggtgcattggttgaaccttctgctgta
gcacttcacgctgtgcgccagagcaaactgaaagtgggagatacggcagctgtgtttggc
gcaggcccaatcggactactggtcatcgaagcgcttaaagcttcgggagcgtcggatatt
tatgtggtggagctatcggatgaacggaaagcaaaagccgaagagctgggtgccattgtg
atagacccaacgcagtttaatgtggtggaagagatccatcaacgtacacaaggcggcgtt
aacgtagcctatgaagtaactggtgttccgcgtgtactgcaacaagccatcgattcgaca
cggattggtggagagttgatgatcgtcagtatttttgaacaggaagcgccgattcacccg
aactcaattgtcatgaaagaacgtacagttaatggcattattggttatcgcgatgtgttc
ccggcggttatcagtctgatggataaaggtttcttcccggctgacaagctggtgaccaaa
cgaatttcgttggatgaagtggtagagcatggatttgaagcactgttgaaagagaaaaat
caggttaagatattggtaaaagctgaatag

DBGET integrated database retrieval system