KEGG   Paenibacillus xylanexedens: BS614_26750Help
Entry
BS614_26750       CDS       T04676                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
pxl  Paenibacillus xylanexedens
Pathway
pxl00051  Fructose and mannose metabolism
pxl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pxl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BS614_26750
Enzymes [BR:pxl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     BS614_26750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh UDPG_MGDP_dh_N 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: APO47295
UniProt: A0A1L5LV71
Position
complement(6148680..6149825)
Genome map
AA seq 381 aa AA seqDB search
MKALHFGAGNIGRGFIGLILSRAGYEVIFSDVNQALVTALQQRGQYTVELANESKDQETV
TGVNAIDGTQLETVAQTVVEADLITTAVGVGVLKHIAPGIAKGLEKRLKSGPAQNPLHII
ACENAIGASTQLKEHVYALLNEEVRSLADQYVYFPDSAVDRIVPIQHHEDPLHVQVEPFY
EWVVDRSQMAPAFKPVEGIVYVDDLEPYIERKLFTVNTGHCVAAYIGNVHGYDTIQKAIA
DEKVKSIVYGALQETGKVLVKRFAFNPEEHEQYIVKILGRFVNPYLTDEVTRVGRSPLRK
LSPNDRLVRPALQAYADGSETTYLAMGMASACKFDVSDDPEAVELQDMIRQKGITAALHH
YTSMDEHHPVLEQAVAQYNQM
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctctacactttggcgcaggtaacattggacgcgggtttatcggattgattctc
tcccgtgcagggtatgaggtgattttctctgacgtgaatcaggccttggtaacagctctc
cagcaacgggggcagtatacggtggaactggccaacgagagcaaggatcaggagaccgtc
acaggtgtaaatgcaatcgatggaacccagctggagacggttgcccaaaccgttgtggaa
gctgatctgattacaaccgcggtgggtgtaggcgtactgaaacatattgcaccaggcatt
gcgaaaggacttgagaaaagactgaaatccggtcctgctcaaaaccctcttcacattatc
gcttgcgagaacgccattggagccagtacgcaattgaaagagcatgtatatgctctgctc
aatgaagaggtacgttcccttgcggatcagtacgtttattttccagattcagccgtagac
cggattgtacctattcagcatcatgaagatccgttgcatgtacaggtggagcctttttac
gagtgggtggtggatcgttcccagatggctcctgcattcaaaccggttgagggcatcgta
tatgtcgatgatctggagccgtatatcgaacgtaaactgttcactgttaatacaggacac
tgcgttgctgcgtacatcggtaatgtgcacggttatgacacgattcagaaggctattgcc
gacgagaaggtgaaatcgattgtatacggtgctttgcaggaaactggaaaagttctagtg
aagcgttttgcattcaacccggaagaacatgagcagtatattgtcaaaatattgggacgc
tttgtcaacccgtatcttaccgatgaggttactcgtgttggtcgttccccgctgcgcaag
ttgtctccgaatgatcgtctggttcgcccggcccttcaggcatatgcggatggaagcgaa
acgacctatctggctatgggcatggcatcagcctgcaagttcgatgtctccgatgatccc
gaagcagttgaactacaggacatgatccgccagaaggggataacagctgcgctccaccat
tatacgtctatggatgagcatcatccggtgcttgaacaggctgttgcccagtataaccaa
atgtaa

DBGET integrated database retrieval system