KEGG   Paenibacillus xylanexedens: BS614_27715Help
Entry
BS614_27715       CDS       T04676                                 

Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
pxl  Paenibacillus xylanexedens
Pathway
pxl00520  Amino sugar and nucleotide sugar metabolism
pxl01100  Metabolic pathways
pxl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pxl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BS614_27715
Enzymes [BR:pxl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     BS614_27715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3 Hydrolase
Motif
Other DBs
NCBI-ProteinID: APO47457
UniProt: A0A1L5LVP7
Position
complement(6364729..6365949)
Genome map
AA seq 406 aa AA seqDB search
MTGANSHEPGSQRDENISLLRGKLLLSNEILEDGVIAWRGEKILYAGVPEGLPEQIRREA
LPLSVPERGLIVPGFIDIHVHGGNREDFMDASPEVLDKITSFHSTQGTTAMLATSMTAPK
ERLDSVLAEVERYRSSEMPYAQLEGVHLEGPFFSPKWPGAQNPEHIMLPDVSWLEAWEKQ
YPGLIRQVTLAPEREGALEVISWLREQRITAALGHTDATYEEVERAVEAGLHHAVHTFNA
MTPLHHRLPGAAGAVLSDPRISAEVIADGIHVHPAAISILAQLKQHNDQLVLITDAMSAA
GLDDGEYKIGDLPVIVKHGEARLKDGGALAGSTLTMIRGFRYLVQEVGLSLNAASRAASL
TPARLLGIDHRTGSLAQGKQADIVLLNAELDIEGVWVKGRRIGESY
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgaccggagcgaatagccatgaacctgggagccagcgtgatgaaaatatttctcttctt
cggggcaagctgctcctttcaaatgagatattggaagatggtgtaatagcctggaggggc
gagaaaatcctctatgctggggtaccggaaggtctgcctgaacagattcggcgagaggct
ttgccgctgtctgtaccggaacgcggcctcattgtgcctggattcattgatattcatgtg
catggtgggaacagagaagattttatggacgcaagcccggaggtgttggacaagatcact
tctttccatagtacacagggcacaacagcgatgcttgcgacttccatgacggctccaaaa
gagcgactggatagcgtacttgctgaagtggaacgctaccgttcgagtgaaatgccatat
gcacagcttgagggtgtgcacttggagggtccatttttcagtccgaaatggcctggtgcg
caaaatccggaacatatcatgctgcctgatgtatcctggcttgaagcatgggagaagcaa
tatcccggccttatccgtcaagttacgttggcaccggaacgtgaaggggcactggaagtc
atctcgtggctgcgagaacagcggattacagcggcactcggccacacggatgcgacctat
gaagaggtggagcgggcagtggaagcaggacttcatcatgcggtacatacgtttaatgcc
atgacaccgctgcatcaccggctacccggggctgccggagccgtgctgagtgatccacgt
atcagtgctgaggtgattgctgacggcattcatgtgcaccctgcggcgatatcaatcctc
gctcaattgaagcaacataacgatcaactcgtgttgatcacagatgccatgtctgctgcg
ggattggatgacggagagtataaaatcggcgatctgcccgtaatcgtgaagcatggcgag
gccagactgaaggacggcggcgcactggcgggaagtacgttgacaatgattcgcggtttc
cgttacctggtacaggaagtgggcttgagcctgaacgctgcatcacgtgcagcaagcctg
accccggcacgcctgctcggcattgatcatcggacaggttccctggctcaaggaaaacag
gcagatattgttttgctgaatgcggagctggatattgagggtgtatgggtcaagggaaga
cggatcggcgagtcatattag

DBGET integrated database retrieval system