KEGG   Plutella xylostella (diamondback moth): 105379988Help
Entry
105379988         CDS       T03915                                 

Definition
(RefSeq) methionine--tRNA ligase, mitochondrial-like
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
pxy  Plutella xylostella (diamondback moth)
Pathway
pxy00450  Selenocompound metabolism
pxy00970  Aminoacyl-tRNA biosynthesis
pxy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pxy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    105379988
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    105379988
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pxy01007]
    105379988
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pxy03016]
    105379988
Enzymes [BR:pxy01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     105379988
Amino acid related enzymes [BR:pxy01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   105379988
Transfer RNA biogenesis [BR:pxy03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    105379988
 Prokaryotic type
   Other AARSs
    105379988
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 SUKH_6
Motif
Other DBs
NCBI-GeneID: 105379988
NCBI-ProteinID: XP_011547767
Position
Un
AA seq 586 aa AA seqDB search
MRLNIRLLAAVKQNFFITTPIFYVNAAPHIGHLYTALVADAVQRFEKLVHPDINVVFTTG
TDEHGTKIQQAAAKANLPLPEYCTKISQEYKDLFKEFNIGYTDFVRTTEERHKTAVRHFW
NKLKEDDYIYKASYAGWYSVNDEAFVPDTHVKDQNRDGEMVSRFYNFLDIKSSGSSVSVN
DEALVPDTHVKDQNRDGEMVKVSLESGHAVEWTEETNYMFRLSAFKTHLQRWLKTDGLIT
PHKFQKQLQDMVAGDAYLPDISVSRPASRVHWAIRVPDDDTQSIYVWLDALVNYLTVGGY
PRPPAPLHPPDLHVLGKDILKFHGIYWPAFLMAIKWHPPRAILCHGHWTVDGAKMSKSLH
NVVSPRDSEVGSEGLRYFLLSEHTLHSDANYSTTKLINTVNASLADTLGNLVSRCSGPAL
NPRGELPPPSRLNCALCQLHKATKFLIVAEKCHHFYSNYQFYKAVDSVIEVLHMANLYFE
EQKPWELRKRIECQKDLDDILHITMETLRVCGIILQPIIPELSTKLLDKLSVPKDERTWE
HCEKMSWLETGAIREMRHIQSGKFVLFQRVYTDKDKKTAKEKKVNV
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgcggttaaatatacggctgttagcagctgtgaaacagaactttttcataactactcct
atattttatgtcaatgcagctccgcacataggtcacctgtacacggcgctggtcgctgac
gcggtgcagaggttcgagaagcttgtgcatcctgatatcaatgttgtctttaccacaggc
acggacgagcatggcactaagatccagcaagcggcagcaaaggccaacctgcctctaccg
gagtattgcaccaagatctctcaggagtacaaagatctgttcaaggagtttaatattggg
tatacagattttgtccggaccacagaggagagacataagactgctgttcggcatttttgg
aacaagctgaaagaggatgattacatctacaaggcgagctacgcgggctggtacagtgtc
aacgacgaggcgttcgtacccgacactcacgtgaaggaccaaaacagggacggggaaatg
gtgagtaggttttataactttttggatataaagagcagtggtagctcagtcagcgtcaac
gacgaggcgttggtacccgacactcacgtgaaggaccaaaacagggacggggaaatggtg
aaagtgtcgctagagtccggtcatgccgtggaatggacggaggaaactaactacatgttc
cgcctgagcgccttcaagactcatctgcagaggtggctcaagacagatggcctgatcact
ccacacaagttccagaaacagttacaagacatggtggccggcgatgcgtatctacccgac
atctctgtgagcagacccgcgtctagagtgcattgggctatacgggtgcctgacgacgac
acacagagtatctacgtgtggctggacgcgcttgtcaactatttaacggtgggagggtac
ccgcgcccccccgcgcccctgcacccccccgacctgcacgtgctggggaaggacatactc
aaattccacggcatatactggccggcattcctaatggcgatcaaatggcacccgccgcgc
gccatcttgtgccacggacactggacagtcgacggcgccaagatgtccaagtctctacac
aacgtggtcagtccaagggacagtgaagtgggcagtgagggcctgaggtacttcctgttg
agcgagcacacgcttcatagtgatgccaactacagcacaacaaagctaatcaacaccgtc
aacgcatccctggccgacaccctcggcaacttggtgtcgcggtgctcggggccggcgttg
aacccccgcggggagctgcccccgccttcccgtcttaattgcgccctatgtcaacttcat
aaagcaaccaagttccttattgttgcagagaaatgccaccacttctacagcaactaccaa
ttctacaaggctgtagactcagtcatagaggtactccacatggccaacctatacttcgag
gagcagaaaccctgggaactccgcaagagaatagaatgccagaaagacctagatgacatc
ctacatataaccatggaaacgcttagggtttgcgggatcattctacagcctatcatcccg
gagttatcgaccaaactgctggataaactgtcggtgccgaaagatgagaggacttgggag
cattgcgaaaagatgtcttggttggaaacgggggctattcgtgagatgaggcatattcag
agcggcaagtttgttctgttccaaagggtttatacggataaggataagaaaactgccaag
gagaaaaaagttaatgtgtaa

DBGET integrated database retrieval system