KEGG   Plutella xylostella (diamondback moth): 105380903Help
Entry
105380903         CDS       T03915                                 

Definition
(RefSeq) probable maleylacetoacetate isomerase 2
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
pxy  Plutella xylostella (diamondback moth)
Pathway
pxy00350  Tyrosine metabolism
pxy01100  Metabolic pathways
Module
pxy_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:pxy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    105380903
Enzymes [BR:pxy01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     105380903
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C GST_C_2
Motif
Other DBs
NCBI-GeneID: 105380903
NCBI-ProteinID: XP_011549186
Position
Un
AA seq 218 aa AA seqDB search
MGDIVEKPVLYSYWRSSCSWRVRIALNLKEIPYDIKAVSLIKGGGEQHCNEYREVNPMEQ
VPSLCIDGHTLIESLSILHYLEETRPQRPLMPQDCYKRAKVREICEVISSGIQPLQNLVV
LIYVGEEKKKEWAAHWMTRGFRAVERLLSGSAGKYCVGDEITLADCCLVPQVFNARRFHV
DLRPFPIILRIDRELEHHPAFRAAHPSTQPDCPPEAAK
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatattgtagaaaaaccggtgctctactcctactggcgcagctcgtgctcgtgg
cgggtgcgcatcgcgctcaacctcaaggagatcccgtacgacatcaaggccgtcagcctg
atcaagggcggcggcgagcaacactgcaacgagtaccgggaagtcaaccccatggagcaa
gtgccgtctttgtgcattgatgggcacaccctcatagagtcactaagcatactgcattat
ttagaagagaccagacctcaaagaccactgatgcctcaagactgctacaagcgggccaaa
gttagagagatatgtgaggtgataagctccggcatccagccgctccaaaacctggtcgtc
ctaatctacgtaggagaagagaagaagaaagaatgggctgcgcactggatgacgcgtggt
ttccgcgccgtggagcgcctgctgtcgggctcggccggcaagtactgcgtgggcgacgag
atcacgctggcagattgctgcctcgtgccgcaggtcttcaacgctaggagattccacgta
gacctgcgcccgttccccatcatcctgcgcatagaccgcgagctggagcaccacccggcg
ttccgcgcggcgcacccgtccacgcagcccgactgcccgcccgaagccgccaagtga

DBGET integrated database retrieval system