KEGG   Plutella xylostella (diamondback moth): 105381350Help
Entry
105381350         CDS       T03915                                 

Definition
(RefSeq) carnitine O-palmitoyltransferase 1, liver isoform
  KO
K08765  carnitine O-palmitoyltransferase 1, liver isoform [EC:2.3.1.21]
Organism
pxy  Plutella xylostella (diamondback moth)
Pathway
pxy00071  Fatty acid degradation
pxy01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pxy00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    105381350
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pxy03029]
    105381350
Enzymes [BR:pxy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     105381350
Mitochondrial biogenesis [BR:pxy03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    105381350
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N
Motif
Other DBs
NCBI-GeneID: 105381350
NCBI-ProteinID: XP_011549359
Position
Un
AA seq 647 aa AA seqDB search
MAEAHSAVAFSFAITHDGWDVNFDREVLYLVWESGVRSWKKRLARFRNSVHNGVYPGHLQ
SLYVLWSMLVAAHFSGLNIIPFGLVGKAMAILPGETAVWQVAACLIAALTMWLSVIFLMR
YMLKMLLMYKGWMYESRVPGAKISLKTKLWVSVVKVLSGWNKPKLYSFQGSLPRLPLPKV
KDTMRRYLVSVRPLLDDDNYARVEKKAREFEQTIAVKLQRYLVLKSWWSSNYVSDWWEEY
VYLRGRSPLMVNSNFYGIDTICSKSTRKQAARAAVVVHLCLQFRRLIDRQELEPDVEYRI
DENPKNLEPVGRLLLHGNGHDRWFDKSFNLCFSTDGFVGFNAEHTWADAPVMGHLWEYVI
WTELEGSYNSKGDALGTVETPPPPPTRLQWELQSEPLVKALDTSYEVSQKILNDVDLRIL
MYTKYGKGFMKKCRTSPDGFIQLILQLSYYRDAGRFCLTYEASMTRMFREGRTETVRPCT
IESAAWVKAMVDPKVSVEDRMRLFRAATHRHQLGYQDAMCGQGIDRHLFCLYVVSKYLEL
DSPFLQEVFNEPWRLSTSQTPHGQTSKLDLKNHPECISAGGGFGPVADDGYGVSYIIAGD
DTLFFHVSCNKTCPKTSASNFVKEIERSLADVKEMFLTYNKLQEKKA
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagcgcactccgccgtggcgttttcgttcgcgatcacgcacgacggctgggac
gtcaacttcgaccgggaggtgctgtacctggtgtgggagtcgggcgtcaggtcctggaag
aagcgcctggctaggttccggaacagcgtccacaatggcgtgtacccgggtcacctgcag
tctctctacgtgctgtggtcgatgctggtggctgcccacttctccgggctgaacatcata
cccttcggcctggtggggaaggccatggccatactgcccggggagacggcggtgtggcag
gtagcggcgtgcctcatagcggctctcaccatgtggctgtcggtgatcttcctcatgcgg
tatatgctcaaaatgctgcttatgtacaagggctggatgtacgagtcccgggtcccaggc
gccaagatctcgctcaagaccaagctgtgggtgagcgtggtgaaggtgctgtcaggatgg
aacaagcccaagctgtacagcttccaggggtcgctgccgaggctgccgctgccgaaggtc
aaggacaccatgcgaaggtacctggtgagcgtgcggcctcttctcgacgatgacaactac
gctcgcgtggagaagaaagcacgcgagttcgagcagaccatcgcggtgaagctgcagaga
tacctggtgctcaagagctggtggtcaagcaactacgtgtccgactggtgggaagagtac
gtgtacctccgcggtcgttcacccctgatggtcaactccaacttctacggcatcgacacg
atctgcagcaagagtacgaggaagcaggcggcgcgcgcggccgtggtagtgcacttgtgt
ctgcagttccgccggctgattgataggcaggagctggagccggacgtggagtaccgtatc
gacgagaaccccaagaacctggagccggtggggcggctgctgctgcacggcaacggacac
gaccgctggttcgacaagtccttcaacctgtgcttcagcacggatggctttgttggcttc
aatgcggaacatacctgggcggacgcgccagtcatgggtcatttgtgggagtacgttatc
tggacagaactggaaggcagctacaactcaaaaggcgacgcgctgggcacagtggaaacc
cccccgccgccccccacccgcctgcagtgggagctgcagagtgaacccctggtgaaggct
ctggacacgtcgtacgaggtcagccagaagatactcaacgatgtggatctgaggatactc
atgtatactaagtatgggaaaggcttcatgaagaaatgccgcacctcgcccgacggtttc
atccagctgatcctgcagctgtcttactaccgggacgcggggcgcttctgcctcacgtac
gaggcgtctatgactcgcatgttccgggagggacgcacggagactgtcaggccttgtact
attgagagtgctgcgtgggttaaagcgatggtggaccctaaagtttcggtagaagaccgc
atgcgtctattccgcgcggcgacccaccgacaccagctcggctaccaggacgccatgtgc
gggcagggcatcgaccgccacctgttctgtctctacgtggtctccaagtacttggagctg
gactcgcccttcctgcaggaggtgtttaatgagccgtggcggctgtccacgagtcagacg
ccgcatggtcaaaccagcaagctggacctgaagaaccaccccgagtgcatatctgctggc
gggggcttcggcccggtcgccgacgacggctacggagtctcctacatcatcgccggagac
gacacgctcttcttccacgtgtcttgcaataagacctgcccgaagactagtgcatcgaac
ttcgtgaaggaaatagaacggtctctggcggatgtcaaggagatgttcctcacttacaac
aagctacaggagaagaaggcctag

DBGET integrated database retrieval system