KEGG   Plutella xylostella (diamondback moth): 105382012Help
Entry
105382012         CDS       T03915                                 

Definition
(RefSeq) dedicator of cytokinesis protein 7-like
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
pxy  Plutella xylostella (diamondback moth)
Brite
KEGG Orthology (KO) [BR:pxy00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pxy04131]
    105382012
Membrane trafficking [BR:pxy04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    105382012
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 TFIIF_beta
Motif
Other DBs
NCBI-GeneID: 105382012
NCBI-ProteinID: XP_011550134
Position
Un
AA seq 1484 aa AA seqDB search
MEYGQLHSSVLLETDKLRDEDLYKYLAEIKRPSAAPRKLKCIPGTLKIEVMPCPDEIMNG
LTPELAKLHPYGDDNVRPCKEIISFPLQPPPVPHYQYRNLLYVYPKEIFLAAFPSRARNI
TVRIQLLSGENQEDALPAIFGRSSCPEFSTEAYTTVLYHNKNPSLYDEIKLKLPADLGDQ
HHLLFTFLHVSCQRKPVPQGQEKDLTTVLGYSWIPLCRNGKLTCGEFSLPVLRDPPPRHY
SYISPDVQLPGTRWLGNHKPALLVTLHLLSTVHPSAPGTRWLDNHKPVLLVTLHPLSTVH
PLDSSIERFAIACEAIQEGNIPSRIGLTNMEAELRASIAELPTANVHTLARYSSVLLDKL
VALLVTSPALAGAPLNIAQDAFTCLAQLFTDITNMNEGATCDAHNRSSILSTYIQYQCQI
PRPALTDQDVGLPLPPTVLVDGSCKVLHEELALQWVVASGATRDLAMHNSWAFFELMIKS
MVEYLAWSGARAAARKARFPDHYTDDVTTLVNNVTAEIIAKYEKNSRLTQSLNNSLAFFL
FDLLSIADRGWVLALTRGYCKQVAAKIASLPDAVVLVHYKLNFMRIICSHEHLVPLSLPP
APRSRPPSPLSSRVSASSCAAPALSAAFRAAHYLPAALLSDVAAALDLPSPVLQNAAVSS
ILALLTSHDGDPRLLSAENRARVAALYMPLLSVAMDACPLLSRPGNASSDILPLDNDLDF
LDQFYPTASPDGENKPPSRAPFNSETSRNLLLLVCWVLKWSSDSALAACVGSLSRRRLLA
LLQLVHRCFAHHQYKGRKETMQRTQQAGGDIKARLEDVILGQGSAREDFIMRRKAGTQMS
GKRERWRKECWGRPPPAPPPPPALAPALAAEVSMTLLHTIEIIVKTCSVLECGQAVATAA
LQVLLAALQRPQSVSVLQHMLATVRSLIIKLGGACGVEGRVCRVVLAHCGAAHAASRAHA
SATLYTLMRTHYTLPQNFSGVKMQMTMSLSSLVGTRDTLSEHSLRRALRTMLTYAEHDQD
LAGTSFPEQVKDLVFNLHMILSDTVKMKEFQQDPEMLLDLMHRIARGYQHSPDLRLTWLS
NMAQKHMERSNHTEAGIGAALLEPVTHNALLEAVTEPAAPPRLPTDLQALLEHAASELMT
AGMYETVNEVYKVLIPIAEQNRDYKKLANIHSKLTDAFTRIEQLHGKRVFGTYFRVGFYG
APLGDLANTEFIYKEHALTKLPEIFSRLENFYSQRFGADNVVIIKDSNTVDAATLDPDKA
YIQITYVEPYFEPYELRKRVTTYERNHNIKRFMYCTPFTADGRAHGDIAEQCKRKTVLTT
AQHFPYVKTRLQVVQRTQIILTPIEVAIEDIQKKTQELAAATTQEPADAKMLQMVVQGCI
GTTVNQGPLELAQVFLAPVAEGTQPPTRLSNKLRLAFKDFSKKCHDALKKNKNLIGSDQR
EYQRELERNLARFTERLAPLVQPTPGHAALLCNGLNKPDYKFQT
NT seq 4455 nt NT seq  +upstreamnt  +downstreamnt
atggaatatggtcagctccattcttcagtcttactagaaacagacaagctccgtgacgaa
gacctctacaagtacttggccgagatcaaacggccgagcgccgcgccgcgcaagctcaag
tgtattcctgggaccttgaagatagaagtgatgccgtgtcctgatgaaatcatgaatgga
ttgactccggagctggcgaagttacatccttatggagacgacaacgtccgtccgtgtaaa
gagattatctcgttcccgctgcagccgccaccggtacctcactatcagtacagaaactta
ctgtacgtctaccctaaagagatcttcctcgctgccttcccgtctagggccaggaatatt
accgtccgtatacaactgctatcaggcgagaaccaagaggacgcgctgcccgccatcttc
ggacgaagttcctgtccagagttcagcaccgaggcgtataccaccgtgctgtatcataat
aaaaacccatccctctacgacgagatcaagctcaaactgccagcggacctgggggaccag
caccacctgctgttcacattcctgcacgtgtcgtgccagcgcaagcccgtgccgcagggg
caggagaaggacctcactactgtgctggggtactcgtggatcccgctctgccgcaacggc
aaactaacctgcggcgagttctccctgcccgttttacgggaccccccgccgcggcactac
tcgtacatctcgcccgacgtgcaactccccggcactcgctggctcggcaaccacaagccc
gcgctgctcgtgaccctgcacttgctgtctactgtgcacccctctgctcccggcacgcgc
tggctcgacaaccacaagcccgtgctgctcgtgaccctgcacccgctgtctactgtgcac
ccgctggacagcagtatcgagcggttcgccatcgcgtgcgaggcgatacaggaggggaat
ataccgtcgcggatcggactcaccaacatggaggctgagctgagagccagcatagcagag
ctgcccacagccaatgtgcacacgctcgcccgctacagcagcgtgctgctggacaagctg
gtggcgctgctggtgacgtcacccgcgctggccggcgcgccgctcaacatagcgcaggac
gccttcacgtgcctcgcgcagctcttcactgacatcactaacatgaacgagggtgcaaca
tgcgacgcgcacaaccgctcgtccatcctgagcacgtacatccagtaccagtgccagatc
ccgcgccccgcgctcaccgaccaggacgtggggctgccgctgcctcctactgtgctggtg
gacgggtcctgcaaggtgctgcacgaggagctggcgctgcagtgggtggtggccagcggc
gccacgcgcgacctggccatgcacaactcatgggcattcttcgagctgatgatcaaatcc
atggtggagtacctggcgtggtcgggcgcgcgcgcggcggcccgcaaggcgcgcttcccg
gaccactacaccgatgacgtcaccacgctcgtcaacaacgtcaccgccgagatcatcgcc
aaatacgaaaagaacagccgtctcacccaaagcctgaacaacagcctggccttcttcctc
ttcgacttactcagcatagcggaccggggctgggtgctggccctgacccgcggctactgc
aagcaggtggccgccaagatcgcctcgctgcccgacgccgtcgtgctcgtgcattacaag
ctaaacttcatgcgcataatctgctcgcacgagcacttagtcccgctgagcctgccgccc
gccccgcgctcccgcccgccctcgcccctctcctcgcgcgtgtcggcctcgtcgtgcgcc
gcgcccgccctcagcgccgccttccgcgccgcgcactacctgcccgccgccttgttgagc
gatgtggccgctgcactggatctgccaagcccagtgctccagaacgcggcagtcagctct
atcctagccctcctcacctcccacgacggagaccctcgcctcttgtcggcggagaacagg
gcccgcgtggccgcgctctacatgccgctgctgagcgtcgccatggacgcctgcccgctg
ctgagccgccccgggaacgctagcagcgatatactgccgctggacaatgacttggacttc
ctcgaccagttctacccgaccgcgtcgccggacggagaaaacaagccgccatcccgcgcc
cccttcaacagcgagacctcccgcaacctgctgctcctcgtctgctgggttctcaagtgg
tcctcagactcggcgctggcggcgtgcgtgggctcgctgtcgcgccgccggctgctcgcg
ctgctgcagctcgtgcaccgctgcttcgcgcaccaccagtacaagggccgcaaagaaacc
atgcagagaacacagcaggccggcggcgacatcaaggcgcggctcgaggacgtcatcctg
ggccagggctccgccagggaggacttcatcatgaggaggaaggcgggcacccagatgtcc
ggcaagcgcgagcgctggcgcaaggagtgctggggccgcccgccccccgcgccgccgccg
ccccccgcgctcgcccccgccctcgccgctgaggtctccatgacgctgctgcatacgatt
gagattattgttaagacatgcagcgtgctggagtgcgggcaggcggtcgccacggccgcg
ctgcaggtgctgctggccgcgctgcagcgcccccagagcgtctccgtgctgcagcacatg
ctggccaccgtcagatcactcattattaagctgggcggcgcatgcggcgtggaagggcgc
gtgtgccgcgtggtcctagcgcactgcggcgccgcgcacgccgcctcgcgcgcgcacgcc
tccgccacgctgtacacgctcatgcgcacgcactacacgctgccgcagaacttcagcggc
gtcaagatgcagatgacgatgtccctctcctccctagtcgggactcgggacacgctgagc
gagcactctttgcgccgcgcgctccggaccatgctgacctacgccgagcacgaccaggac
ctggctggcaccagcttcccggagcaggtgaaagacctagtgttcaacctgcacatgatc
ctatcagacacggtgaagatgaaggagttccagcaggacccagagatgctgctggacctg
atgcaccgcatcgcgcgcggctaccagcacagcccggacctgcggctcacgtggctcagc
aacatggcgcagaaacacatggagcgctccaaccacacggaagccggcatcggcgccgcg
ctgctcgagccggtgactcataatgcgctgctcgaggccgtcaccgagcccgccgcgccg
ccgcgcctgccgactgacctgcaggcattactggagcacgcggcgagtgaactaatgaca
gcggggatgtacgagaccgtgaacgaagtgtacaaggtgctcattccgatagcggaacag
aatagagactacaagaaactggccaatatacacagcaaactaacagacgcgttcacgcgc
atagagcagctgcacggcaagcgcgtgttcggcacgtacttccgcgtggggttctacgga
gcccccctcggagacctcgccaacaccgagttcatatataaagaacatgccttgacgaag
ttaccggagatatttagtagactcgagaacttctacagccagcgtttcggcgcggacaac
gtggtgatcatcaaggactcgaacacggtggacgcggcgactctagacccggacaaggcc
tacatccagatcacctacgtggaaccctacttcgagccctacgagctgaggaaaagggtc
actacgtatgaacggaatcataatatcaagcgcttcatgtactgcaccccgttcacggcg
gacgggcgcgcgcacggcgacatcgcggagcagtgcaagcgcaagaccgtgctcaccacc
gcgcaacacttcccctacgtcaagacgcgcctacaggttgtacaaagaacccaaatcata
ctgactcccattgaagtggcgattgaagacattcagaagaagacgcaagagctagcggct
gcgacgacgcaagagcccgctgacgccaagatgctccagatggtggtgcagggctgcatc
ggcaccaccgtcaaccaggggccgctggaactggcacaggtgttcctggcgccggtagcg
gagggcacacagccgcccacgcggctcagcaacaagctgcgcctcgcgttcaaggacttc
tccaagaaatgccacgacgccctcaagaagaacaagaacctgatcgggtcggaccagcgc
gagtaccagcgcgagctggagcgcaacctggcgcgcttcacggagcgcctggcgccgctc
gtgcagcccacgcccggacacgccgcgctgctgtgcaatggactcaacaaaccggactac
aagtttcaaacataa

DBGET integrated database retrieval system